Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FHIT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Rabbit FHIT Polyclonal Antibody | anti-FHIT antibody

FHIT antibody - middle region

Gene Names
FHIT; FRA3B; AP3Aase
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FHIT; Polyclonal Antibody; FHIT antibody - middle region; anti-FHIT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF
Sequence Length
147
Applicable Applications for anti-FHIT antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FHIT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FHIT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-FHIT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)
Related Product Information for anti-FHIT antibody
This is a rabbit polyclonal antibody against FHIT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17
NCBI Official Full Name
bis(5'-adenosyl)-triphosphatase isoform 1
NCBI Official Synonym Full Names
fragile histidine triad
NCBI Official Symbol
FHIT
NCBI Official Synonym Symbols
FRA3B; AP3Aase
NCBI Protein Information
bis(5'-adenosyl)-triphosphatase
UniProt Protein Name
Bis(5'-adenosyl)-triphosphatase
UniProt Gene Name
FHIT
UniProt Synonym Gene Names
AP3Aase
UniProt Entry Name
FHIT_HUMAN

NCBI Description

The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. [provided by RefSeq, Aug 2017]

Uniprot Description

FHIT: a member of the histidine triad gene family. A diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. Its gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. A possible tumor suppressor in specific tissues. Phospho-FHIT observed in liver and kidney, but not in brain and lung. Phospho-FHIT undetected in all tested human tumor cell lines. Aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas.

Protein type: Hydrolase; EC 3.6.1.29; Motility/polarity/chemotaxis; Nucleotide Metabolism - purine; Tumor suppressor; DNA replication

Chromosomal Location of Human Ortholog: 3p14.2

Cellular Component: mitochondrion; cytoplasm; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; hydrolase activity; ubiquitin protein ligase binding; bis(5'-adenosyl)-triphosphatase activity; nucleotide binding; catalytic activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; nucleotide metabolic process; DNA replication; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; purine nucleotide metabolic process

Research Articles on FHIT

Similar Products

Product Notes

The FHIT fhit (Catalog #AAA3210228) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FHIT antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FHIT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FHIT fhit for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VHVLPRKAGD FHRNDSIYEE LQKHDKEDFP ASWRSEEEMA AEAAALRVYF. It is sometimes possible for the material contained within the vial of "FHIT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.