Western Blot (WB)
(Western Blot analysis of FGL1 expression in transfected 293T cell line by FGL1 polyclonal antibody. Lane 1: FGL1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human, Mouse FGL1 Polyclonal Antibody | anti-FGL1 antibody
FGL1 (Fibrinogen-Like 1, HFREP1, HP-041, LFIRE1, MGC12455) (FITC)
Gene Names
FGL1; HFREP1; HP-041; LFIRE1; LFIRE-1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGL1; Polyclonal Antibody; FGL1 (Fibrinogen-Like 1; HFREP1; HP-041; LFIRE1; MGC12455) (FITC); anti-FGL1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FGL1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-FGL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FGL1, aa1-312 (NP_004458.3).
Immunogen Sequence
MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of FGL1 expression in transfected 293T cell line by FGL1 polyclonal antibody. Lane 1: FGL1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FGL1 expression in transfected 293T cell line by FGL1 polyclonal antibody. Lane 1: FGL1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FGL1 antibody
Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta-and gamma-subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene.
Product Categories/Family for anti-FGL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,379 Da
NCBI Official Full Name
fibrinogen-like protein 1
NCBI Official Synonym Full Names
fibrinogen like 1
NCBI Official Symbol
FGL1
NCBI Official Synonym Symbols
HFREP1; HP-041; LFIRE1; LFIRE-1
NCBI Protein Information
fibrinogen-like protein 1
UniProt Protein Name
Fibrinogen-like protein 1
Protein Family
UniProt Gene Name
FGL1
UniProt Synonym Gene Names
HFREP1; HFREP-1; LFIRE-1
NCBI Description
Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Has hepatocyte mitogenic activity.
Research Articles on FGL1
Similar Products
Product Notes
The FGL1 fgl1 (Catalog #AAA6378573) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGL1 (Fibrinogen-Like 1, HFREP1, HP-041, LFIRE1, MGC12455) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FGL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGL1 fgl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
