Western Blot (WB)
(Western blot analysis of extracts of Rat liver, using FGF3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Rabbit anti-Rat FGF3 Polyclonal Antibody | anti-FGF3 antibody
FGF3 Rabbit pAb
Gene Names
FGF3; INT2; HBGF-3
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
FGF3; Polyclonal Antibody; FGF3 Rabbit pAb; HBGF-3; INT2; anti-FGF3 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMN
Applicable Applications for anti-FGF3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation:
WB: Gallus gallus
IF: Gallus gallus
Customer Validation:
WB: Gallus gallus
IF: Gallus gallus
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1).
Positive Samples
Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Rat liver, using FGF3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Western Blot (WB)
(Western blot analysis of extracts of Rat liver, using FGF3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-FGF3 antibody
Background: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,887 Da
NCBI Official Full Name
fibroblast growth factor 3
NCBI Official Synonym Full Names
fibroblast growth factor 3
NCBI Official Symbol
FGF3
NCBI Official Synonym Symbols
INT2; HBGF-3
NCBI Protein Information
fibroblast growth factor 3; FGF-3; oncogene INT2; proto-oncogene Int-2; INT-2 proto-oncogene protein; heparin-binding growth factor 3; murine mammary tumor virus integration site 2, mouse; V-INT2 murine mammary tumor virus integration site oncogene homolo
UniProt Protein Name
Fibroblast growth factor 3
Protein Family
UniProt Gene Name
FGF3
UniProt Synonym Gene Names
INT2; FGF-3; HBGF-3
UniProt Entry Name
FGF3_HUMAN
Similar Products
Product Notes
The FGF3 fgf3 (Catalog #AAA9142487) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF3 Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Gallus gallus IF: Gallus gallus. Researchers should empirically determine the suitability of the FGF3 fgf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLIWLLLLS LLEPGWPAAG PGARLRRDAG GRGGVYEHLG GAPRRRKLYC ATKYHLQLHP SGRVNGSLEN SAYSILEITA VEVGIVAIRG LFSGRYLAMN. It is sometimes possible for the material contained within the vial of "FGF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
