Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FGF12 expression in transfected 293T cell line by FGF12 polyclonal antibody. Lane 1: FGF12 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FGF12 Polyclonal Antibody | anti-FGF12 antibody

FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (FITC)

Gene Names
FGF12; FHF1; EIEE47; FGF12B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGF12; Polyclonal Antibody; FGF12 (Fibroblast Growth Factor 12; FGF-12; Fibroblast Growth Factor Homologous Factor 1; FHF-1; Myocyte-activating Factor; FHF1; FGF12B) (FITC); anti-FGF12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FGF12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
243
Applicable Applications for anti-FGF12 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FGF12, aa1-243 (NP_066360.1).
Immunogen Sequence
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FGF12 expression in transfected 293T cell line by FGF12 polyclonal antibody. Lane 1: FGF12 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FGF12 expression in transfected 293T cell line by FGF12 polyclonal antibody. Lane 1: FGF12 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FGF12 antibody
FGF12 is probably involved in nervous system development and function.
Product Categories/Family for anti-FGF12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
fibroblast growth factor 12 isoform 1
NCBI Official Synonym Full Names
fibroblast growth factor 12
NCBI Official Symbol
FGF12
NCBI Official Synonym Symbols
FHF1; EIEE47; FGF12B
NCBI Protein Information
fibroblast growth factor 12
UniProt Protein Name
Fibroblast growth factor 12
Protein Family
UniProt Gene Name
FGF12
UniProt Synonym Gene Names
FGF12B; FHF1; FGF-12; FHF-1
UniProt Entry Name
FGF12_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. [provided by RefSeq, Dec 2019]

Uniprot Description

FGF12: Probably involved in nervous system development and function. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: extracellular space; nucleus

Molecular Function: heparin binding; growth factor activity; sodium channel regulator activity; fibroblast growth factor receptor binding

Biological Process: nervous system development; synaptic transmission; fibroblast growth factor receptor signaling pathway; cell-cell signaling; adult locomotory behavior; heart development; neuromuscular process; JNK cascade; signal transduction

Research Articles on FGF12

Similar Products

Product Notes

The FGF12 fgf12 (Catalog #AAA6378474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGF12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF12 fgf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGF12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.