Rabbit FGB Polyclonal Antibody | anti-FGB antibody

Anti-FGB Antibody

Cat. Num. AAA178640

• Gene Names: FGB; HEL-S-78p
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: FGB; Polyclonal Antibody; Anti-FGB Antibody; Fibrinogen beta chain; Fibrinopeptide B; HEL S 78p; HEL-S-78p; P02675; anti-FGB antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 432

• Applicable Applications for anti-FGB antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5ug/ml
• Notes: Tested Species: In-house tested species with positive results.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of FGB expression in rat kidney extract (lane 1), mouse liver extract (lane 2) and HELA whole cell lysates (lane 3). FGB at 56KD was detected using rabbit anti- FGB Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-FGB antibody

Rabbit IgG polyclonal antibody for Fibrinogen beta chain (FGB) detection.
Background: Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

References

1. "Entrez Gene: FGB fibrinogen beta chain".
2. Chung, D. W., Que, B. G., Rixon, M. W., Mace, M., Jr., Davie, E. W. Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen. Biochemistry 22: 3244-3250, 1983.
3. Spena, S., Duga, S., Asselta, R., Malcovati, M., Peyvandi, F., Tenchini, M. L. Congenital afibrinogenemia: first identification of splicing mutations in the fibrinogen B-beta-chain gene causing activation of cryptic splice sites. Blood 100: 4478-4484, 2002.

NCBI and Uniprot Product Information

• NCBI GI #: 296080754
• NCBI GeneID: 2244
• NCBI Accession #: NP_001171670.1
• NCBI GenBank Nucleotide #: NM_001184741.1
• UniProt Accession #: P02675; Q32Q65; Q3KPF2; A0JLR9; B2R7G3
• Molecular Weight: 55,928 Da
• NCBI Official Full Name: fibrinogen beta chain isoform 2 preproprotein
• NCBI Official Synonym Full Names: fibrinogen beta chain
• NCBI Official Symbol: FGB
• NCBI Official Synonym Symbols: HEL-S-78p
• NCBI Protein Information: fibrinogen beta chain
• UniProt Protein Name: Fibrinogen beta chain
• Protein Family: Fibrinogen
• UniProt Gene Name: FGB

NCBI Description

The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

Uniprot Description

FGB: Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation. Defects in FGB are a cause of congenital afibrinogenemia (CAFBN). This rare autosomal recessive disorder is characterized by bleeding that varies from mild to severe and by complete absence or extremely low levels of plasma and platelet fibrinogen. Patients with congenital fibrinogen abnormalities can manifest different clinical pictures. Some cases are clinically silent, some show a tendency toward bleeding and some show a predisposition for thrombosis with or without bleeding.

Protein type: Adaptor/scaffold; Cell surface; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q31.3

Cellular Component: cell surface; external side of plasma membrane; extracellular region; extracellular space; fibrinogen complex; plasma membrane

Molecular Function: cell adhesion molecule binding; chaperone binding; protein binding; receptor binding; structural molecule activity

Biological Process: blood coagulation; cell-matrix adhesion; cellular protein complex assembly; extracellular matrix organization and biogenesis; fibrinolysis; induction of bacterial agglutination; plasminogen activation; platelet degranulation; positive regulation of exocytosis; positive regulation of heterotypic cell-cell adhesion; positive regulation of protein secretion; positive regulation of vasoconstriction; protein polymerization; response to calcium ion

Disease: Afibrinogenemia, Congenital; Dysfibrinogenemia, Congenital