Western Blot (WB)
(WB Suggested Anti-FCRL1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Rabbit FCRL1 Polyclonal Antibody | anti-FCRL1 antibody
FCRL1 antibody - N-terminal region
Gene Names
FCRL1; FCRH1; IFGP1; IRTA5; CD307a
Reactivity
Cow, Horse, Human, Mouse
Applications
Western Blot
Purity
Protein A purified
Synonyms
FCRL1; Polyclonal Antibody; FCRL1 antibody - N-terminal region; anti-FCRL1 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
Sequence Length
429
Applicable Applications for anti-FCRL1 antibody
Western Blot (WB)
Homology
Cow: 93%; Horse: 83%; Human: 100%; Mouse: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FCRL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FCRL1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-FCRL1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-FCRL1 antibody
This is a rabbit polyclonal antibody against FCRL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.
Target Description: FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.
Product Categories/Family for anti-FCRL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
Fc receptor-like protein 1 isoform 1
NCBI Official Synonym Full Names
Fc receptor like 1
NCBI Official Symbol
FCRL1
NCBI Official Synonym Symbols
FCRH1; IFGP1; IRTA5; CD307a
NCBI Protein Information
Fc receptor-like protein 1
UniProt Protein Name
Fc receptor-like protein 1
Protein Family
UniProt Gene Name
FCRL1
UniProt Synonym Gene Names
FCRH1; IFGP1; IRTA5
UniProt Entry Name
FCRL1_HUMAN
NCBI Description
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transmembrane domain and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs. This protein may play a role in the regulation of cancer cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Research Articles on FCRL1
Similar Products
Product Notes
The FCRL1 fcrl1 (Catalog #AAA3209847) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCRL1 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FCRL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCRL1 fcrl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLPRLLLLIC APLCEPAELF LIASPSHPTE GSPVTLTCKM PFLQSSDAQF. It is sometimes possible for the material contained within the vial of "FCRL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
