Western Blot (WB)
(Western Blot analysis of FCN2 expression in human colon usingMBS6005306.)
Rabbit anti-Human FCN2 Polyclonal Antibody | anti-FCN2 antibody
FCN2 (Ficolin-2, 37kD Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL) (Biotin)
Gene Names
FCN2; P35; FCNL; EBP-37; ficolin-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FCN2; Polyclonal Antibody; FCN2 (Ficolin-2; 37kD Elastin-binding Protein; Collagen/Fibrinogen Domain-containing Protein 2; EBP-37; Ficolin-B; Ficolin-beta; Hucolin; L-ficolin; Serum Lectin p35; FCNL) (Biotin); anti-FCN2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FCN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1002
Applicable Applications for anti-FCN2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-313 from human FCN2.
Immunogen Sequence
MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of FCN2 expression in human colon usingMBS6005306.)
Western Blot (WB)
(Western Blot analysis of FCN2 expression in human colon usingMBS6005306.)
Western Blot (WB)
(Western Blot analysis of FCN2 expression in transfected 293T cell line byMBS6005306. Lane 1: FCN2 transfected lysate (34kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FCN2 expression in transfected 293T cell line byMBS6005306. Lane 1: FCN2 transfected lysate (34kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FCN2 antibody
May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.
Product Categories/Family for anti-FCN2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin), mRNA
NCBI Official Synonym Full Names
ficolin 2
NCBI Official Symbol
FCN2
NCBI Official Synonym Symbols
P35; FCNL; EBP-37; ficolin-2
NCBI Protein Information
ficolin-2
Protein Family
NCBI Description
The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Research Articles on FCN2
Similar Products
Product Notes
The FCN2 (Catalog #AAA6378352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCN2 (Ficolin-2, 37kD Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FCN2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FCN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
