Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FCGR2CSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit FCGR2C Polyclonal Antibody | anti-FCGR2C antibody

FCGR2C Antibody - N-terminal region

Gene Names
FCGR2C; CD32; FCG2; CD32C; CDW32; IGFR2; FCRIIC
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCGR2C; Polyclonal Antibody; FCGR2C Antibody - N-terminal region; anti-FCGR2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD
Sequence Length
323
Applicable Applications for anti-FCGR2C antibody
Western Blot (WB)
Homology
Cow: 90%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Rabbit: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FCGR2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FCGR2CSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FCGR2CSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: FCGR2CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FCGR2CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FCGR2C antibody
This is a rabbit polyclonal antibody against FCGR2C. It was validated on Western Blot

Target Description: This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
Product Categories/Family for anti-FCGR2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-c
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIc (gene/pseudogene)
NCBI Official Symbol
FCGR2C
NCBI Official Synonym Symbols
CD32; FCG2; CD32C; CDW32; IGFR2; FCRIIC
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-c
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-c
UniProt Gene Name
FCGR2C
UniProt Synonym Gene Names
CD32; FCG2; IGFR2; IgG Fc receptor II-c; Fc-gamma-RIIc; FcRII-c
UniProt Entry Name
FCG2C_HUMAN

NCBI Description

This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants. [provided by RefSeq, Apr 2012]

Uniprot Description

FCGR2C: a transmembrane receptor for the Fc region of complexed or aggregated immunoglobulin gamma (IgG). Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down modulation of previous state of cell activation triggered via antigen receptors on B cells, T cells or via another Fc receptor. Three splice-variant isoforms have been observed.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: cytoplasm; plasma membrane; integral to membrane

Molecular Function: protein binding; transmembrane receptor activity; IgG binding

Biological Process: immune response; signal transduction

Disease: Thrombocytopenic Purpura, Autoimmune

Research Articles on FCGR2C

Similar Products

Product Notes

The FCGR2C fcgr2c (Catalog #AAA3217345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCGR2C Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FCGR2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCGR2C fcgr2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTHSPESDSI PWFHNGNLIP THTQPSYRFK ANNNDSGEYT CQTGQTSLSD. It is sometimes possible for the material contained within the vial of "FCGR2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.