Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FCGR2BSample Type: 721_BAntibody Dilution: 1.0ug/mlFCGR2B is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human FCGR2B Polyclonal Antibody | anti-FCGR2B antibody

FCGR2B antibody - C-terminal region

Gene Names
FCGR2B; CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcRII-c
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCGR2B; Polyclonal Antibody; FCGR2B antibody - C-terminal region; anti-FCGR2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
Sequence Length
290
Applicable Applications for anti-FCGR2B antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FCGR2BSample Type: 721_BAntibody Dilution: 1.0ug/mlFCGR2B is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: FCGR2BSample Type: 721_BAntibody Dilution: 1.0ug/mlFCGR2B is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-FCGR2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-FCGR2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-FCGR2B antibody
This is a rabbit polyclonal antibody against FCGR2B. It was validated on Western Blot

Target Description: The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-FCGR2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-b isoform 2
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIb
NCBI Official Symbol
FCGR2B
NCBI Official Synonym Symbols
CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcRII-c
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-b
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-b
UniProt Gene Name
FCGR2B
UniProt Synonym Gene Names
CD32; FCG2; IGFR2; IgG Fc receptor II-b; Fc-gamma-RIIb; FcRII-b
UniProt Entry Name
FCG2B_HUMAN

NCBI Description

The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

FCGR2B: a transmembrane receptor for the Fc region of complexed or aggregated immunoglobulin gamma (IgG). Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down modulation of previous state of cell activation triggered via antigen receptors on B cells, T cells or via another Fc receptor. Three splice-variant isoforms have been observed.

Protein type: Membrane protein, integral; Cell surface; Oncoprotein

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; IgG binding

Biological Process: regulation of immune response; viral reproduction; immune response; signal transduction

Disease: Systemic Lupus Erythematosus; Malaria, Susceptibility To

Research Articles on FCGR2B

Similar Products

Product Notes

The FCGR2B fcgr2b (Catalog #AAA3216069) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCGR2B antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCGR2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCGR2B fcgr2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VALIYCRKKR ISANPTNPDE ADKVGAENTI TYSLLMHPDA LEEPDDQNRI. It is sometimes possible for the material contained within the vial of "FCGR2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.