Western Blot (WB)
(Host: RabbitTarget Name: FCER2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human FCER2 Polyclonal Antibody | anti-FCER2 antibody
FCER2 Antibody - C-terminal region
Gene Names
FCER2; CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCER2; Polyclonal Antibody; FCER2 Antibody - C-terminal region; anti-FCER2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTP
Sequence Length
321
Applicable Applications for anti-FCER2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FCER2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FCER2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FCER2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FCER2 antibody
This is a rabbit polyclonal antibody against FCER2. It was validated on Western Blot
Target Description: The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Target Description: The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-FCER2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
low affinity immunoglobulin epsilon Fc receptor isoform a
NCBI Official Synonym Full Names
Fc fragment of IgE receptor II
NCBI Official Symbol
FCER2
NCBI Official Synonym Symbols
CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2
NCBI Protein Information
low affinity immunoglobulin epsilon Fc receptor
UniProt Protein Name
Low affinity immunoglobulin epsilon Fc receptor
Protein Family
UniProt Gene Name
FCER2
UniProt Synonym Gene Names
CD23A; CLEC4J; FCE2; IGEBF
UniProt Entry Name
FCER2_HUMAN
NCBI Description
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
Uniprot Description
Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Research Articles on FCER2
Similar Products
Product Notes
The FCER2 fcer2 (Catalog #AAA3216674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCER2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCER2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCER2 fcer2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRWNDAFCDR KLGAWVCDRL ATCTPPASEG SAESMGPDSR PDPDGRLPTP. It is sometimes possible for the material contained within the vial of "FCER2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
