Western Blot (WB)
(WB Suggested Anti-FASTKD2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateFASTKD2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Rabbit anti-Horse, Human FASTKD2 Polyclonal Antibody | anti-FASTKD2 antibody
FASTKD2 antibody - middle region
Gene Names
FASTKD2; KIAA0971
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FASTKD2; Polyclonal Antibody; FASTKD2 antibody - middle region; anti-FASTKD2 antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
Sequence Length
710
Applicable Applications for anti-FASTKD2 antibody
Western Blot (WB)
Homology
Horse: 87%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FASTKD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FASTKD2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateFASTKD2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(WB Suggested Anti-FASTKD2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateFASTKD2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-FASTKD2 antibody
This is a rabbit polyclonal antibody against FASTKD2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
Target Description: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
Product Categories/Family for anti-FASTKD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
FAST kinase domain-containing protein 2, mitochondrial
NCBI Official Synonym Full Names
FAST kinase domains 2
NCBI Official Symbol
FASTKD2
NCBI Official Synonym Symbols
KIAA0971
NCBI Protein Information
FAST kinase domain-containing protein 2, mitochondrial
UniProt Protein Name
FAST kinase domain-containing protein 2
Protein Family
UniProt Gene Name
FASTKD2
UniProt Synonym Gene Names
KIAA0971
UniProt Entry Name
FAKD2_HUMAN
NCBI Description
This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency. [provided by RefSeq, Oct 2008]
Uniprot Description
FASTKD2: a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency. [provided by RefSeq, Oct 2008]
Protein type: RNA-binding
Chromosomal Location of Human Ortholog: 2q33.3
Cellular Component: mitochondrion
Molecular Function: protein kinase activity
Biological Process: cellular respiration; protein amino acid phosphorylation
Disease: Mitochondrial Complex Iv Deficiency
Research Articles on FASTKD2
Similar Products
Product Notes
The FASTKD2 fastkd2 (Catalog #AAA3212061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FASTKD2 antibody - middle region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's FASTKD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FASTKD2 fastkd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTNRNQVLPL SDVDTTSATD IQRVAVLCVS RSAYCLGSSH PRGFLAMKMR. It is sometimes possible for the material contained within the vial of "FASTKD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
