Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FAM3C Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Rabbit FAM3C Polyclonal Antibody | anti-FAM3C antibody

FAM3C antibody - C-terminal region

Gene Names
FAM3C; ILEI; GS3786
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM3C; Polyclonal Antibody; FAM3C antibody - C-terminal region; anti-FAM3C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Sequence Length
227
Applicable Applications for anti-FAM3C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 91%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FAM3C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FAM3C Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-FAM3C Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-FAM3C antibody
This is a rabbit polyclonal antibody against FAM3C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Alternate transcriptional splice variants which encode the same protein have been characterized.
Product Categories/Family for anti-FAM3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
protein FAM3C
NCBI Official Synonym Full Names
family with sequence similarity 3 member C
NCBI Official Symbol
FAM3C
NCBI Official Synonym Symbols
ILEI; GS3786
NCBI Protein Information
protein FAM3C
UniProt Protein Name
Protein FAM3C
Protein Family
UniProt Gene Name
FAM3C
UniProt Synonym Gene Names
ILEI
UniProt Entry Name
FAM3C_HUMAN

NCBI Description

This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010]

Uniprot Description

FAM3C: May be involved in retinal laminar formation. Promotes epithelial to mesenchymal transition. Belongs to the FAM3 family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q31

Cellular Component: Golgi apparatus; cytoplasmic membrane-bound vesicle; extracellular region

Molecular Function: cytokine activity

Biological Process: multicellular organismal development

Research Articles on FAM3C

Similar Products

Product Notes

The FAM3C fam3c (Catalog #AAA3207585) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM3C antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FAM3C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM3C fam3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DNWVFCGGKG IKTKSPFEQH IKNNKDTNKY EGWPEVVEME GCIPQKQD. It is sometimes possible for the material contained within the vial of "FAM3C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.