Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FAM126A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

Rabbit FAM126A Polyclonal Antibody | anti-FAM126A antibody

FAM126A antibody - C-terminal region

Gene Names
FAM126A; HCC; HLD5; HYCC1; DRCTNNB1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM126A; Polyclonal Antibody; FAM126A antibody - C-terminal region; anti-FAM126A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG
Sequence Length
521
Applicable Applications for anti-FAM126A antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FAM126A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FAM126A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-FAM126A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)
Related Product Information for anti-FAM126A antibody
This is a rabbit polyclonal antibody against FAM126A. It was validated on Western Blot

Target Description: FAM126A may play a part in the beta-catenin/Lef signaling pathway. Expression of FAM126A gene is down-regulated by beta-catenin. Defects in FAM126A gene are a cause of hypomyelination with congenital cataract (HCC).
Product Categories/Family for anti-FAM126A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
hyccin isoform 1
NCBI Official Synonym Full Names
family with sequence similarity 126 member A
NCBI Official Symbol
FAM126A
NCBI Official Synonym Symbols
HCC; HLD5; HYCC1; DRCTNNB1A
NCBI Protein Information
hyccin
UniProt Protein Name
Hyccin
Protein Family
UniProt Gene Name
FAM126A
UniProt Synonym Gene Names
DRCTNNB1A
UniProt Entry Name
HYCCI_HUMAN

NCBI Description

The protein encoded by this gene may play a part in the beta-catenin/Lef signaling pathway. Expression of this gene is down-regulated by beta-catenin. Defects in this gene are a cause of hypomyelination with congenital cataract (HCC). [provided by RefSeq, Oct 2008]

Research Articles on FAM126A

Similar Products

Product Notes

The FAM126A fam126a (Catalog #AAA3214718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM126A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM126A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM126A fam126a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEISEVDEGF YSRAASSTSQ SGLSNSSHNC SNKPSIGKNH RRSGGSKTGG. It is sometimes possible for the material contained within the vial of "FAM126A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.