Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: METTL21ASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Rabbit FAM119A Polyclonal Antibody | anti-METTL21A antibody

FAM119A antibody - N-terminal region

Gene Names
METTL21A; FAM119A; HCA557b; HSPA-KMT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM119A; Polyclonal Antibody; FAM119A antibody - N-terminal region; anti-METTL21A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI
Sequence Length
218
Applicable Applications for anti-METTL21A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FAM119A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: METTL21ASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: METTL21ASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-FAM119A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-FAM119A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)
Related Product Information for anti-METTL21A antibody
This is a rabbit polyclonal antibody against FAM119A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.
Product Categories/Family for anti-METTL21A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
protein N-lysine methyltransferase METTL21A isoform 1
NCBI Official Synonym Full Names
methyltransferase like 21A
NCBI Official Symbol
METTL21A
NCBI Official Synonym Symbols
FAM119A; HCA557b; HSPA-KMT
NCBI Protein Information
protein N-lysine methyltransferase METTL21A
UniProt Protein Name
Protein N-lysine methyltransferase METTL21A
UniProt Gene Name
METTL21A
UniProt Synonym Gene Names
FAM119A; HCA557B
UniProt Entry Name
MT21A_HUMAN

Uniprot Description

FAM119A: a methyltransferase of the METTL21 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase, protein lysine; Membrane protein, integral; EC 2.1.1.-

Chromosomal Location of Human Ortholog: 2q33.3

Cellular Component: cytoplasm

Molecular Function: protein binding; protein-lysine N-methyltransferase activity; Hsp70 protein binding; ATPase binding

Biological Process: regulation of ATPase activity; protein amino acid methylation; peptidyl-lysine methylation

Research Articles on METTL21A

Similar Products

Product Notes

The METTL21A mettl21a (Catalog #AAA3211003) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM119A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM119A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the METTL21A mettl21a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALVPYEETTE FGLQKFHKPL ATFSFANHTI QIRQDWRHLG VAAVVWDAAI. It is sometimes possible for the material contained within the vial of "FAM119A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.