Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FADD and BID. HeLa cells were stained with FADD rabbit purified polyclonal 1:1200 and BID mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Rabbit anti-Human FADD Polyclonal Antibody | anti-FADD antibody

FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (PE)

Gene Names
FADD; GIG3; MORT1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FADD; Polyclonal Antibody; FADD (Fas-Associated Death Domain Protein; Growth-inhibiting Gene 3 Protein; GIG3; Mediator of Receptor Induced Toxicity; MORT1; MGC8528; Protein FADD) (PE); anti-FADD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FADD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FADD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FADD, aa1-208 (NP_003815.1).
Immunogen Sequence
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FADD and BID. HeLa cells were stained with FADD rabbit purified polyclonal 1:1200 and BID mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FADD and BID. HeLa cells were stained with FADD rabbit purified polyclonal 1:1200 and BID mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(Western Blot analysis of FADD expression in transfected 293T cell line by FADD polyclonal antibody. Lane 1: FADD transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FADD expression in transfected 293T cell line by FADD polyclonal antibody. Lane 1: FADD transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(FADD rabbit polyclonal antibody. Western Blot analysis of FADD expression in human kidney.)

Western Blot (WB) (FADD rabbit polyclonal antibody. Western Blot analysis of FADD expression in human kidney.)
Related Product Information for anti-FADD antibody
FADD (Fas-associated protein with death domain) is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. This protein is implicated in survival/proliferation and cell cycle progression. FADD functions are also regulated via cellular sublocalization, protein phosphorylation, and inhibitory molecules. Recombinant FADD protein was expressed in E. coli and purified by using conventional chromatography techniques.
Product Categories/Family for anti-FADD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,279 Da
NCBI Official Full Name
protein FADD
NCBI Official Synonym Full Names
Fas (TNFRSF6)-associated via death domain
NCBI Official Symbol
FADD
NCBI Official Synonym Symbols
GIG3; MORT1
NCBI Protein Information
protein FADD; growth-inhibiting gene 3 protein; mediator of receptor induced toxicity; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein
UniProt Protein Name
Protein FADD
UniProt Gene Name
FADD
UniProt Synonym Gene Names
MORT1
UniProt Entry Name
FADD_HUMAN

NCBI Description

The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq, Jul 2008]

Uniprot Description

FADD: an adaptor molecule that mediates apoptosis. Recruited through its C-terminal death domain by Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TRAIL-receptor, participating in the death signaling initiated by these receptors. Interaction with the receptors unmasks the N-terminal effector domain of this protein, which recruits caspase-8, and thereby activates the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development.

Protein type: Adaptor/scaffold; Apoptosis

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: neuron projection; CD95 death-inducing signaling complex; cytosol; lipid raft

Molecular Function: identical protein binding; protein binding; protease binding; death receptor binding; protein complex binding; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: viral reproduction; positive regulation of proteolysis; protein heterooligomerization; apoptosis; positive regulation of apoptosis; positive regulation of T cell mediated cytotoxicity; T cell differentiation in the thymus; toll-like receptor 3 signaling pathway; positive regulation of activated T cell proliferation; positive regulation of interleukin-8 production; T cell homeostasis; positive regulation of macrophage differentiation; defense response to virus; toll-like receptor 4 signaling pathway; positive regulation of adaptive immune response; caspase activation; spleen development; positive regulation of I-kappaB kinase/NF-kappaB cascade; thymus development; MyD88-independent toll-like receptor signaling pathway; positive regulation of tumor necrosis factor production; lymph node development; positive regulation of interferon-gamma production; induction of apoptosis via death domain receptors; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter

Disease: Infections, Recurrent, With Encephalopathy, Hepatic Dysfunction, And Cardiovascular Malformations

Research Articles on FADD

Similar Products

Product Notes

The FADD fadd (Catalog #AAA6377975) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FADD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FADD fadd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FADD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.