Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FABP5 rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in human kidney.)

Rabbit anti-Human, Mouse FABP5 Polyclonal Antibody | anti-FABP5 antibody

FABP5 (Fatty Acid-binding Protein, Epidermal, Epidermal-type Fatty Acid-binding Protein, E-FABP, Fatty Acid-binding Protein 5, Psoriasis-associated Fatty Acid-binding Protein Homolog, PA-FABP) (FITC)

Gene Names
FABP5; EFABP; KFABP; E-FABP; PAFABP; PA-FABP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FABP5; Polyclonal Antibody; FABP5 (Fatty Acid-binding Protein; Epidermal; Epidermal-type Fatty Acid-binding Protein; E-FABP; Fatty Acid-binding Protein 5; Psoriasis-associated Fatty Acid-binding Protein Homolog; PA-FABP) (FITC); anti-FABP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FABP5. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-FABP5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FABP5, aa1-135 (NP_001435.1).
Immunogen Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FABP5 rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in human kidney.)

Western Blot (WB) (FABP5 rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in human kidney.)

Western Blot (WB)

(FABP5 rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in mouse stomach.)

Western Blot (WB) (FABP5 rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in mouse stomach.)

Western Blot (WB)

(Western Blot analysis of FABP5 expression in transfected 293T cell line by FABP5 polyclonal antibody. Lane 1: FABP5 transfected lysate (15.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FABP5 expression in transfected 293T cell line by FABP5 polyclonal antibody. Lane 1: FABP5 transfected lysate (15.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FABP5 antibody
FABPs have been reported to be involved in the uptake and metabolism of fatty acids, maintenance of cellular membrane fatty acids levels, intracellular trafficking, modulation of specific enzymes of lipid metabolic pathways, as well as in the modulation of cell growth and differentiation.
Product Categories/Family for anti-FABP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,164 Da
NCBI Official Full Name
fatty acid-binding protein, epidermal
NCBI Official Synonym Full Names
fatty acid binding protein 5 (psoriasis-associated)
NCBI Official Symbol
FABP5
NCBI Official Synonym Symbols
EFABP; KFABP; E-FABP; PAFABP; PA-FABP
NCBI Protein Information
fatty acid-binding protein, epidermal; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog
UniProt Protein Name
Fatty acid-binding protein, epidermal
UniProt Gene Name
FABP5
UniProt Synonym Gene Names
E-FABP; PA-FABP
UniProt Entry Name
FABP5_HUMAN

NCBI Description

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]

Uniprot Description

FABP5: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: protein binding; transporter activity; fatty acid binding; lipid binding

Biological Process: epidermis development; phosphatidylcholine biosynthetic process; glucose metabolic process; glucose transport; lipid metabolic process

Research Articles on FABP5

Similar Products

Product Notes

The FABP5 fabp5 (Catalog #AAA6377902) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FABP5 (Fatty Acid-binding Protein, Epidermal, Epidermal-type Fatty Acid-binding Protein, E-FABP, Fatty Acid-binding Protein 5, Psoriasis-associated Fatty Acid-binding Protein Homolog, PA-FABP) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FABP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FABP5 fabp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FABP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.