Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FABP1 expression in transfected 293T cell line by FABP1 MaxPab polyclonal antibody.Lane 1: FABP1 transfected lysate(14.20 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human FABP1 Polyclonal Antibody | anti-FABP1 antibody

FABP1 (Fatty Acid Binding Protein 1, liver, FABPL, L-FABP) (APC)

Gene Names
FABP1; FABPL; L-FABP
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
FABP1; Polyclonal Antibody; FABP1 (Fatty Acid Binding Protein 1; liver; FABPL; L-FABP) (APC); Fatty Acid Binding Protein 1; L-FABP; anti-FABP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FABP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FABP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FABP1 (NP_001434.1, 1aa-127aa) full-length human protein.
Immunogen Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FABP1 expression in transfected 293T cell line by FABP1 MaxPab polyclonal antibody.Lane 1: FABP1 transfected lysate(14.20 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FABP1 expression in transfected 293T cell line by FABP1 MaxPab polyclonal antibody.Lane 1: FABP1 transfected lysate(14.20 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-FABP1 antibody
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq]
Product Categories/Family for anti-FABP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,208 Da
NCBI Official Full Name
fatty acid-binding protein, liver
NCBI Official Synonym Full Names
fatty acid binding protein 1, liver
NCBI Official Symbol
FABP1
NCBI Official Synonym Symbols
FABPL; L-FABP
NCBI Protein Information
fatty acid-binding protein, liver; fatty acid-binding protein 1; liver-type fatty acid-binding protein

NCBI Description

This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]

Research Articles on FABP1

Similar Products

Product Notes

The FABP1 (Catalog #AAA6450883) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FABP1 (Fatty Acid Binding Protein 1, liver, FABPL, L-FABP) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FABP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FABP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FABP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.