Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EZH1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human EZH1 Polyclonal Antibody | anti-EZH1 antibody

EZH1 Antibody - C-terminal region

Gene Names
EZH1; KMT6B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EZH1; Polyclonal Antibody; EZH1 Antibody - C-terminal region; anti-EZH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNL
Sequence Length
677
Applicable Applications for anti-EZH1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EZH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EZH1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EZH1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-EZH1 antibody
This is a rabbit polyclonal antibody against EZH1. It was validated on Western Blot

Target Description: EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
histone-lysine N-methyltransferase EZH1 isoform 1
NCBI Official Synonym Full Names
enhancer of zeste 1 polycomb repressive complex 2 subunit
NCBI Official Symbol
EZH1
NCBI Official Synonym Symbols
KMT6B
NCBI Protein Information
histone-lysine N-methyltransferase EZH1
UniProt Protein Name
Histone-lysine N-methyltransferase EZH1
UniProt Gene Name
EZH1
UniProt Synonym Gene Names
KIAA0388
UniProt Entry Name
EZH1_HUMAN

NCBI Description

EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity (Shen et al., 2008 [PubMed 19026780]).[supplied by OMIM, Mar 2009]

Uniprot Description

EZH1: Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH1-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. Belongs to the histone-lysine methyltransferase family. EZ subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.43; Methyltransferase; Methyltransferase, protein lysine

Chromosomal Location of Human Ortholog: 17q21.1-q21.3

Cellular Component: nucleoplasm; ESC/E(Z) complex

Molecular Function: chromatin binding; histone lysine N-methyltransferase activity (H3-K27 specific)

Biological Process: anatomical structure morphogenesis; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on EZH1

Similar Products

Product Notes

The EZH1 ezh1 (Catalog #AAA3219141) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EZH1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EZH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EZH1 ezh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVAGWGTFIK ESVQKNEFIS EYCGELISQD EADRRGKVYD KYMSSFLFNL. It is sometimes possible for the material contained within the vial of "EZH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.