Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ESR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Rabbit ESR1 Polyclonal Antibody | anti-ESR1 antibody

ESR1 antibody - N-terminal region

Gene Names
ESR1; ER; ESR; Era; ESRA; ESTRR; NR3A1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ESR1; Polyclonal Antibody; ESR1 antibody - N-terminal region; anti-ESR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGS
Sequence Length
595
Applicable Applications for anti-ESR1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ESR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ESR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-ESR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-ESR1 antibody
This is a rabbit polyclonal antibody against ESR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodi

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
estrogen receptor isoform 1
NCBI Official Synonym Full Names
estrogen receptor 1
NCBI Official Symbol
ESR1
NCBI Official Synonym Symbols
ER; ESR; Era; ESRA; ESTRR; NR3A1
NCBI Protein Information
estrogen receptor
UniProt Protein Name
Estrogen receptor
Protein Family
UniProt Gene Name
ESR1
UniProt Synonym Gene Names
ESR; NR3A1; ER
UniProt Entry Name
ESR1_HUMAN

NCBI Description

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Mar 2014]

Uniprot Description

ER-alpha: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: nucleoplasm; Golgi apparatus; membrane; cytoplasm; plasma membrane; integral to membrane; nucleus

Molecular Function: identical protein binding; estrogen receptor activity; zinc ion binding; nitric-oxide synthase regulator activity; beta-catenin binding; estrogen response element binding; transcription factor binding; steroid binding; protein binding; enzyme binding; steroid hormone receptor activity; chromatin binding; transcription factor activity

Biological Process: estrogen receptor signaling pathway; positive regulation of nitric oxide biosynthetic process; uterus development; signal transduction; response to estradiol stimulus; regulation of apoptosis; positive regulation of fibroblast proliferation; elevation of cytosolic calcium ion concentration; regulation of transcription, DNA-dependent; epithelial cell development; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; antral ovarian follicle growth; positive regulation of nitric-oxide synthase activity; negative regulation of transcription factor activity; male gonad development; androgen metabolic process; vagina development; positive regulation of retinoic acid receptor signaling pathway; negative regulation of I-kappaB kinase/NF-kappaB cascade; chromatin remodeling; response to estrogen stimulus; gene expression; positive regulation of transcription factor activity; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling

Disease: Breast Cancer; Migraine With Or Without Aura, Susceptibility To, 1; Myocardial Infarction, Susceptibility To; Estrogen Resistance

Research Articles on ESR1

Similar Products

Product Notes

The ESR1 esr1 (Catalog #AAA3203829) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESR1 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ESR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ESR1 esr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LERPLGEVYL DSSKPAVYNY PEGAAYEFNA AAAANAQVYG QTGLPYGPGS. It is sometimes possible for the material contained within the vial of "ESR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.