Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ERGIC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit ERGIC2 Polyclonal Antibody | anti-ERGIC2 antibody

ERGIC2 antibody - middle region

Gene Names
ERGIC2; PTX1; CDA14; Erv41; cd002
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERGIC2; Polyclonal Antibody; ERGIC2 antibody - middle region; anti-ERGIC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPFEDGHTDNHLPLLENNTH
Sequence Length
377
Applicable Applications for anti-ERGIC2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ERGIC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ERGIC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ERGIC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ERGIC2 antibody
This is a rabbit polyclonal antibody against ERGIC2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ERGIC2 belongs to the ERGIC family. It possible play a role in transport between endoplasmic reticulum and Golgi
Product Categories/Family for anti-ERGIC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
endoplasmic reticulum-Golgi intermediate compartment protein 2
NCBI Official Synonym Full Names
ERGIC and golgi 2
NCBI Official Symbol
ERGIC2
NCBI Official Synonym Symbols
PTX1; CDA14; Erv41; cd002
NCBI Protein Information
endoplasmic reticulum-Golgi intermediate compartment protein 2
UniProt Protein Name
Endoplasmic reticulum-Golgi intermediate compartment protein 2
UniProt Gene Name
ERGIC2
UniProt Synonym Gene Names
ERV41; PTX1
UniProt Entry Name
ERGI2_HUMAN

NCBI Description

ERGIC2, or PTX1, is a ubiquitously expressed nuclear protein that is downregulated in prostate carcinoma (Kwok et al., 2001 [PubMed 11445006]).[supplied by OMIM, Aug 2008]

Uniprot Description

PTX1: Possible role in transport between endoplasmic reticulum and Golgi. Belongs to the ERGIC family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p11.22

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; intracellular membrane-bound organelle; membrane; cytoplasm; integral to membrane; nucleolus; nucleus

Molecular Function: protein binding

Biological Process: vesicle-mediated transport

Research Articles on ERGIC2

Similar Products

Product Notes

The ERGIC2 ergic2 (Catalog #AAA3204525) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERGIC2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ERGIC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERGIC2 ergic2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTGMLHGIGK FIVEIICCRF RLGSYKPVNS VPFEDGHTDN HLPLLENNTH. It is sometimes possible for the material contained within the vial of "ERGIC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.