Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ERC1 expression in transfected 293T cell line by ERC1 polyclonal antibody. Lane 1: ERC1 transfected lysate (10.01kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ERC1 Polyclonal Antibody | anti-ERC1 antibody

ERC1 (ELKS, KIAA1081, RAB6IP2, ELKS/Rab6-interacting/CAST Family Member 1, Rab6-interacting Protein 2)

Gene Names
ERC1; ELKS; Cast2; RAB6IP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ERC1; Polyclonal Antibody; ERC1 (ELKS; KIAA1081; RAB6IP2; ELKS/Rab6-interacting/CAST Family Member 1; Rab6-interacting Protein 2); Anti -ERC1 (ELKS; anti-ERC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ERC1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
Applicable Applications for anti-ERC1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ERC1, aa1-91 (AAH05065.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ERC1 expression in transfected 293T cell line by ERC1 polyclonal antibody. Lane 1: ERC1 transfected lysate (10.01kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ERC1 expression in transfected 293T cell line by ERC1 polyclonal antibody. Lane 1: ERC1 transfected lysate (10.01kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ERC1 antibody
Regulatory subunit of the IKK complex. Probably recruits IkappaBalpha/NFKBIA to the complex. May be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. May be involved in vesicle trafficking at the CAZ. May be involved in Rab-6 regulated endosomes to Golgi transport. The protein is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13). Five transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ERC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
128,086 Da
NCBI Official Full Name
ELKS/Rab6-interacting/CAST family member 1 isoform epsilon
NCBI Official Synonym Full Names
ELKS/RAB6-interacting/CAST family member 1
NCBI Official Symbol
ERC1
NCBI Official Synonym Symbols
ELKS; Cast2; RAB6IP2
NCBI Protein Information
ELKS/Rab6-interacting/CAST family member 1; RAB6 interacting protein 2; Rab6-interacting protein 2
UniProt Protein Name
ELKS/Rab6-interacting/CAST family member 1
UniProt Gene Name
ERC1
UniProt Synonym Gene Names
ELKS; KIAA1081; RAB6IP2; ERC-1
UniProt Entry Name
RB6I2_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ERC1: Regulatory subunit of the IKK complex. Probably recruits IkappaBalpha/NFKBIA to the complex. May be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. May be involved in vesicle trafficking at the CAZ. May be involved in Rab-6 regulated endosomes to Golgi transport. Part of a complex with CHUK, IKBKB and IKBKG. Interacts with CHUK, IKBKB and IKBKG. The interaction with IKBKG is independent of CHUK and IKBKB. Interacts with NFKBIA. Isoform 4 interacts with PPFIA1, and through its C-terminus with the PDZ domains of RIMS1 and RIMS2. Interacts with ERC2/CAST1. Interacts with the GTB-bound forms of RAB6A isoform 1 and isoform 2 and with RAB6B. The interaction was strongest with RAB6B, followed by RAB6A isoform 2 and weakest with RAB6A isoform 1. Widely expressed. Isoform 2 and isoform 4 are abundantly expressed in brain. Isoform 1 and isoform 3 are predominantly expressed in testis and thyroid, and isoform 1 predominates in other tissues tested. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: presynaptic membrane; Golgi membrane; cytoplasm; synapse; IkappaB kinase complex

Molecular Function: protein binding; leucine zipper domain binding; Rab GTPase binding; PDZ domain binding

Biological Process: protein transport; regulation of transcription, DNA-dependent; multicellular organismal development; I-kappaB phosphorylation; retrograde transport, endosome to Golgi; activation of NF-kappaB transcription factor

Research Articles on ERC1

Similar Products

Product Notes

The ERC1 erc1 (Catalog #AAA6001668) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ERC1 (ELKS, KIAA1081, RAB6IP2, ELKS/Rab6-interacting/CAST Family Member 1, Rab6-interacting Protein 2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ERC1 erc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKQVVWHGH WPAALSKQVA QIPPTWTFSS GAAPATLSHW VCDSPLHLSI LHHFPSRKTD GRKPSVTLLL RRSISGTDII CLVSVNSKES S. It is sometimes possible for the material contained within the vial of "ERC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.