Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ERBB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit anti-Mouse ERBB2 Polyclonal Antibody | anti-ERBB2 antibody

ERBB2 Antibody - Middle region

Gene Names
Erbb2; Neu; HER2; HER-2; c-neu; Erbb-2; c-erbB2; l11Jus8; mKIAA3023
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ERBB2; Polyclonal Antibody; ERBB2 Antibody - Middle region; anti-ERBB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSRMARDPQRFVVIQNEDLGPSSPMDSTFY
Sequence Length
1256
Applicable Applications for anti-ERBB2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the Middle region of Mouse ERBB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ERBB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-ERBB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: ERBB2Sample Type: Mouse BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ERBB2Sample Type: Mouse BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ERBB2 antibody
This is a rabbit polyclonal antibody against ERBB2. It was validated on Western Blot

Target Description: Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Binds to the 5'-TCAAATTC-3' sequence in the MT-CO2 promoter and activates its transcription (By similarity).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138 kDa
NCBI Official Full Name
receptor tyrosine-protein kinase erbB-2
NCBI Official Synonym Full Names
erb-b2 receptor tyrosine kinase 2
NCBI Official Symbol
Erbb2
NCBI Official Synonym Symbols
Neu; HER2; HER-2; c-neu; Erbb-2; c-erbB2; l11Jus8; mKIAA3023
NCBI Protein Information
receptor tyrosine-protein kinase erbB-2
UniProt Protein Name
Receptor tyrosine-protein kinase erbB-2
UniProt Gene Name
Erbb2
UniProt Synonym Gene Names
Kiaa3023; Neu

Uniprot Description

Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization ().

Research Articles on ERBB2

Similar Products

Product Notes

The ERBB2 erbb2 (Catalog #AAA3200103) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERBB2 Antibody - Middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ERBB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERBB2 erbb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSRMARDPQR FVVIQNEDLG PSSPMDSTFY. It is sometimes possible for the material contained within the vial of "ERBB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.