Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ERAP1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ERAP1 Polyclonal Antibody | anti-ERAP1 antibody

ERAP1 Antibody - middle region

Gene Names
ERAP1; ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; ERAAP1; PILSAP; PILS-AP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ERAP1; Polyclonal Antibody; ERAP1 Antibody - middle region; anti-ERAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVGDYFFGKCFDAMEVDALNSSHPVSTPVENPAQIREMFDDVSYDKGACI
Sequence Length
941
Applicable Applications for anti-ERAP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ERAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ERAP1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ERAP1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ERAP1 antibody
The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-ERAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
endoplasmic reticulum aminopeptidase 1 isoform b
NCBI Official Synonym Full Names
endoplasmic reticulum aminopeptidase 1
NCBI Official Symbol
ERAP1
NCBI Official Synonym Symbols
ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; ERAAP1; PILSAP; PILS-AP
NCBI Protein Information
endoplasmic reticulum aminopeptidase 1
UniProt Protein Name
Endoplasmic reticulum aminopeptidase 1
UniProt Gene Name
ERAP1
UniProt Synonym Gene Names
APPILS; ARTS1; KIAA0525; A-LAP; PILS-AP
UniProt Entry Name
ERAP1_HUMAN

NCBI Description

The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.[provided by RefSeq, Oct 2010]

Uniprot Description

ARTS1: Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I- binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney. Belongs to the peptidase M1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; EC 3.4.11.-; Protease

Chromosomal Location of Human Ortholog: 5q15

Cellular Component: extracellular space; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; endoplasmic reticulum lumen; extracellular region; integral to membrane; cytosol

Molecular Function: protein binding; interleukin-6 receptor binding; metalloexopeptidase activity; zinc ion binding; interleukin-1, Type II receptor binding; aminopeptidase activity

Biological Process: fat cell differentiation; antigen processing and presentation of peptide antigen via MHC class I; positive regulation of angiogenesis; response to bacterium; regulation of blood pressure; membrane protein ectodomain proteolysis; angiogenesis; antigen processing and presentation of endogenous peptide antigen via MHC class I; regulation of innate immune response

Research Articles on ERAP1

Similar Products

Product Notes

The ERAP1 erap1 (Catalog #AAA3220800) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERAP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERAP1 erap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVGDYFFGKC FDAMEVDALN SSHPVSTPVE NPAQIREMFD DVSYDKGACI. It is sometimes possible for the material contained within the vial of "ERAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.