Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-EPN2 Polyclonal Antibody)

Rabbit anti-Human EPN2 Polyclonal Antibody | anti-EPN2 antibody

EPN2 Polyclonal Antibody

Gene Names
EPN2; EHB21
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
EPN2; Polyclonal Antibody; EPN2 Polyclonal Antibody; EHB21; epsin-2; anti-EPN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.33 mg/ml (varies by lot)
Sequence Length
641
Applicable Applications for anti-EPN2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 120-300 of human EPN2 (NP_683723.2).
Immunogen Sequence
GINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPS
Positive Samples
U-87MG, LO2, HeLa
Cellular Location
Cytoplasm, Cytoplasmic Vesicle, Clathrin-Coated Vesicle
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-EPN2 Polyclonal Antibody)

Western Blot (WB) (Western blot-EPN2 Polyclonal Antibody)
Related Product Information for anti-EPN2 antibody
This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 36kDa; 57kDa; 62kDa; 68kDa
Observed: 70kDa
NCBI Official Full Name
epsin-2 isoform b
NCBI Official Synonym Full Names
epsin 2
NCBI Official Symbol
EPN2
NCBI Official Synonym Symbols
EHB21
NCBI Protein Information
epsin-2
UniProt Protein Name
Epsin-2
UniProt Gene Name
EPN2
UniProt Synonym Gene Names
KIAA1065
UniProt Entry Name
EPN2_HUMAN

NCBI Description

This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

epsin 2: Plays a role in the formation of clathrin-coated invaginations and endocytosis. Belongs to the epsin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle

Molecular Function: lipid binding

Biological Process: Notch signaling pathway; in utero embryonic development; embryonic organ development; endocytosis

Research Articles on EPN2

Similar Products

Product Notes

The EPN2 epn2 (Catalog #AAA9140719) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPN2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the EPN2 epn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.