Mouse anti-Human ENTPD3 Polyclonal Antibody | anti-ENTPD3 antibody

ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, NTPDase 3, CD39 Antigen-like 3, Ecto-ATP Diphosphohydrolase 3, Ecto-ATPDase 3, Ecto-ATPase 3, Ecto-apyrase 3, HB6, CD39L3)

Cat. Num. AAA647904

• Gene Names: ENTPD3; HB6; CD39L3; NTPDase-3
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ENTPD3; Polyclonal Antibody; ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3; NTPDase 3; CD39 Antigen-like 3; Ecto-ATP Diphosphohydrolase 3; Ecto-ATPDase 3; Ecto-ATPase 3; Ecto-apyrase 3; HB6; CD39L3); Anti -ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3; anti-ENTPD3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ENTPD3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEE

• Applicable Applications for anti-ENTPD3 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human ENTPD3, aa1-452 (AAH29869.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ENTPD3 expression in transfected 293T cell line by ENTPD3 polyclonal antibody. Lane 1: ENTPD3 transfected lysate (49.72kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ENTPD3 antibody

Has a threefold preference for the hydrolysis of ATP over ADP.

Product Categories/Family for anti-ENTPD3 antibody

Antibodies; Abs to Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 20988653
• NCBI GeneID: 956
• UniProt Accession #: O75355; O60495; B2R8D0
• Molecular Weight: 59,105 Da
• NCBI Official Full Name: ENTPD3 protein
• NCBI Official Synonym Full Names: ectonucleoside triphosphate diphosphohydrolase 3
• NCBI Official Symbol: ENTPD3
• NCBI Official Synonym Symbols: HB6; CD39L3; NTPDase-3
• NCBI Protein Information: ectonucleoside triphosphate diphosphohydrolase 3; NTPDase 3; CD39-like 3; ecto-ATPase 3; ecto-ATPDase 3; ecto-apyrase 3; CD39 antigen-like 3; ecto-ATP diphosphohydrolase 3
• UniProt Protein Name: Ectonucleoside triphosphate diphosphohydrolase 3
• Protein Family: Ectonucleoside triphosphate diphosphohydrolase
• UniProt Gene Name: ENTPD3
• UniProt Synonym Gene Names: CD39L3; NTPDase 3; Ecto-ATPDase 3
• UniProt Entry Name: ENTP3_HUMAN

NCBI Description

ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Has a threefold preference for the hydrolysis of ATP over ADP.

Catalytic activity: A nucleoside 5'-triphosphate + 2 H2O = a nucleoside 5'-phosphate + 2 phosphate.

Cofactor: Ca2+ or Mg2+.

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.

Sequence similarities: Belongs to the GDA1/CD39 NTPase family.