Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human Enolase, Neuron Specific (NSE) Polyclonal Antibody | anti-NSE antibody

APC/Cy7 Linked Polyclonal Antibody to Enolase, Neuron Specific (NSE)

Gene Names
ENO2; NSE; HEL-S-279
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation
Purity
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
Synonyms
Enolase; Neuron Specific (NSE); Polyclonal Antibody; APC/Cy7 Linked Polyclonal Antibody to Enolase; ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase; anti-NSE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
The antibody is a Rabbit polyclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.
Purity/Purification
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
Form/Format
Liquid
Concentration
>=100ug/ml (varies by lot)
Sequence
NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
Sequence Length
434
Applicable Applications for anti-NSE antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunoprecipitation (IP)
Conjugation
APC-Cy7
Cross Reactivity
Human, Mouse
Preparation and Storage
Store at 4 degree C for frequent use. Aliquot and store at -20 degree C for 12 months.
Avoid repeated freeze/thaw cycles.

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
gamma-enolase
NCBI Official Synonym Full Names
enolase 2
NCBI Official Symbol
ENO2
NCBI Official Synonym Symbols
NSE; HEL-S-279
NCBI Protein Information
gamma-enolase
UniProt Protein Name
Gamma-enolase
UniProt Gene Name
ENO2
UniProt Synonym Gene Names
NSE
UniProt Entry Name
ENOG_HUMAN

NCBI Description

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]

Uniprot Description

ENO2: an enzyme with 2-phospho-D-glycerate hydro-lyase activity. One of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Lyase; EC 4.2.1.11

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: extracellular space; photoreceptor inner segment; phosphopyruvate hydratase complex; plasma membrane; perikaryon; cytosol

Molecular Function: magnesium ion binding; phosphopyruvate hydratase activity

Biological Process: glycolysis; carbohydrate metabolic process; glucose metabolic process; pathogenesis; gluconeogenesis

Research Articles on NSE

Similar Products

Product Notes

The NSE eno2 (Catalog #AAA2107242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APC/Cy7 Linked Polyclonal Antibody to Enolase, Neuron Specific (NSE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Enolase, Neuron Specific (NSE) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the NSE eno2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NSE (Ser2~Leu2 85+TILWSPL RTHLTRMIGL PGPSSQPCRD PDCGVMT). It is sometimes possible for the material contained within the vial of "Enolase, Neuron Specific (NSE), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.