Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ENO3Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ENO3 Polyclonal Antibody | anti-ENO3 antibody

ENO3 Antibody-middle region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENO3; Polyclonal Antibody; ENO3 Antibody-middle region; beta-enolase; MSE; Eno-3; anti-ENO3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
VVIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKNFIQNYPV
Applicable Applications for anti-ENO3 antibody
Western Blot (WB)
Protein Size
434 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ENO3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ENO3Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ENO3Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ENO3 antibody
Description of Target: This gene encodes one of the three enolase isoenzymes found in vertebrates. Enolase is a dimeric enzyme that converts 2-phosphoglycerate to phosphoenolpyruvate as part of the glycolytic pathway. This isozyme is found in skeletal muscle where it is involved in muscle development and regeneration. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
47kDa
UniProt Protein Name
Beta-enolase
Protein Family
UniProt Gene Name
Eno3
UniProt Synonym Gene Names
Eno-3; MSE
UniProt Entry Name
ENOB_MOUSE

Uniprot Description

ENO3: Appears to have a function in striated muscle development and regeneration. Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13). A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen- beta particles are detected on ultrastructural analysis. Belongs to the enolase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 4.2.1.11; Lyase

Cellular Component: extracellular space; phosphopyruvate hydratase complex; membrane; cytoplasm; plasma membrane

Molecular Function: protein homodimerization activity; protein heterodimerization activity; metal ion binding; lyase activity; magnesium ion binding; phosphopyruvate hydratase activity

Biological Process: glycolysis

Similar Products

Product Notes

The ENO3 eno3 (Catalog #AAA3249827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENO3 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ENO3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENO3 eno3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VVIGMDVAAS EFYRNGKYDL DFKSPDDPAR HISGEKLGEL YKNFIQNYPV. It is sometimes possible for the material contained within the vial of "ENO3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.