Western Blot (WB)
(Host: RabbitTarget Name: ENGASESample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human ENGASE Polyclonal Antibody | anti-ENGASE antibody
ENGASE Antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENGASE; Polyclonal Antibody; ENGASE Antibody - N-terminal region; anti-ENGASE antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSF
Sequence Length
377
Applicable Applications for anti-ENGASE antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ENGASE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ENGASESample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ENGASESample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ENGASE antibody
This is a rabbit polyclonal antibody against ENGASE. It was validated on Western Blot
Target Description: This gene encodes a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides.
Target Description: This gene encodes a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides.
Product Categories/Family for anti-ENGASE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
cytosolic endo-beta-N-acetylglucosaminidase
NCBI Official Synonym Full Names
endo-beta-N-acetylglucosaminidase
NCBI Official Symbol
ENGASE
NCBI Protein Information
cytosolic endo-beta-N-acetylglucosaminidase
UniProt Protein Name
Cytosolic endo-beta-N-acetylglucosaminidase
Protein Family
UniProt Gene Name
ENGASE
UniProt Synonym Gene Names
ENGase
NCBI Description
This gene encodes a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides. [provided by RefSeq, Feb 2012]
Uniprot Description
Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core. Involved in the processing of free oligosaccharides in the cytosol.
Research Articles on ENGASE
Similar Products
Product Notes
The ENGASE engase (Catalog #AAA3216641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENGASE Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENGASE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENGASE engase for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRRQLQGLAA PEAGTQEEQE DQEPRPRRRR PGRSIKDEEE ETVFREVVSF. It is sometimes possible for the material contained within the vial of "ENGASE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
