Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit ELL Polyclonal Antibody | anti-ELL antibody

ELL antibody - N-terminal region

Gene Names
ELL; MEN; ELL1; PPP1R68; C19orf17
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ELL; Polyclonal Antibody; ELL antibody - N-terminal region; anti-ELL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
Sequence Length
621
Applicable Applications for anti-ELL antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ELL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(WB Suggested Anti-ELL Antibody Titration: 7.5ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ELL Antibody Titration: 7.5ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-ELL antibody
This is a rabbit polyclonal antibody against ELL. It was validated on Western Blot and immunohistochemistry

Target Description: ELL was shown to encode a previously uncharacterized elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. Functionally, ELL resembles Elongin (SIII), a transcription elongation factor regulated by the product of the von Hippel-Lindau (VHL) tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
RNA polymerase II elongation factor ELL
NCBI Official Synonym Full Names
elongation factor for RNA polymerase II
NCBI Official Symbol
ELL
NCBI Official Synonym Symbols
MEN; ELL1; PPP1R68; C19orf17
NCBI Protein Information
RNA polymerase II elongation factor ELL
UniProt Protein Name
RNA polymerase II elongation factor ELL
Protein Family
UniProt Gene Name
ELL
UniProt Synonym Gene Names
C19orf17
UniProt Entry Name
ELL_HUMAN

Uniprot Description

ELL: Elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. A chromosomal aberration involving ELL is found in acute leukemias. Translocation t(11;19)(q23;p13.1) with MLL/HRX. The result is a rogue activator protein. Belongs to the ELL/occludin family.

Protein type: Transcription initiation complex; Nuclear receptor co-regulator; Oncoprotein

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: nucleoplasm; Cajal body; transcription elongation factor complex; nuclear speck

Molecular Function: protein binding; phosphatase binding

Biological Process: transcription from RNA polymerase II promoter; viral reproduction; positive regulation of RNA elongation from RNA polymerase II promoter; positive regulation of viral transcription; in utero embryonic development; positive regulation of RNA elongation; RNA elongation from RNA polymerase II promoter; snRNA transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase III promoter; gene expression; snRNA transcription from RNA polymerase III promoter

Research Articles on ELL

Similar Products

Product Notes

The ELL ell (Catalog #AAA3204292) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELL antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELL can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ELL ell for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLSCGRVSDG SKVSVFHVKL TDSALRAFES YRARQDSVSL RPSIRFQGSQ. It is sometimes possible for the material contained within the vial of "ELL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.