Rabbit anti-Human ELK4 Polyclonal Antibody | anti-ELK4 antibody

ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (PE)

Cat. Num. AAA6377282

• Gene Names: ELK4; SAP1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ELK4; Polyclonal Antibody; ELK4 (ETS Domain-containing Protein Elk-4; Serum Response Factor Accessory Protein 1; SAP-1; SRF Accessory Protein 1; SAP1) (PE); anti-ELK4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ELK4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 405

• Applicable Applications for anti-ELK4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ELK4, aa1-405 (NP_068567.1).
• Immunogen Sequence: MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ELK4 expression in transfected 293T cell line by ELK4 polyclonal antibody. Lane 1: ELK4 transfected lysate (44.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ELK4 antibody

Forms a ternary complex with the serum response factor (SRF). Requires DNA-bound SRF for ternary complex formation and makes extensive DNA contacts to the 5'side of SRF, but does not bind DNA autonomously.

Product Categories/Family for anti-ELK4 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 11496882
• NCBI GeneID: 2005
• NCBI Accession #: NP_068567.1
• NCBI GenBank Nucleotide #: NM_021795.2
• UniProt Accession #: P28324
• NCBI Official Full Name: ETS domain-containing protein Elk-4 isoform b
• NCBI Official Synonym Full Names: ETS transcription factor ELK4
• NCBI Official Symbol: ELK4
• NCBI Official Synonym Symbols: SAP1
• NCBI Protein Information: ETS domain-containing protein Elk-4
• UniProt Protein Name: ETS domain-containing protein Elk-4
• Protein Family: ETS domain-containing protein
• UniProt Gene Name: ELK4
• UniProt Synonym Gene Names: SAP1; SAP-1; SRF accessory protein 1

NCBI Description

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Involved in both transcriptional activation and repression. Interaction with SIRT7 leads to recruitment and stabilization of SIRT7 at promoters, followed by deacetylation of histone H3 at 'Lys-18' (H3K18Ac) and subsequent transcription repression. Forms a ternary complex with the serum response factor (SRF). Requires DNA-bound SRF for ternary complex formation and makes extensive DNA contacts to the 5'side of SRF, but does not bind DNA autonomously.