ELAVL4 Polyclonal Antibody | anti-ELAVL4 antibody

Anti-ELAVL4 Antibody

Cat. Num. AAA178337

• Gene Names: ELAVL4; HUD; PNEM
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: ELAVL4; Polyclonal Antibody; Anti-ELAVL4 Antibody; ELAV-like protein 4; ELAV (embryonic lethal abnormal vision Drosophila) like 4; ELAV L4; ELAV like 4; ELAV like protein 4; ELAV4_HUMAN; Elavl4; Embryonic lethal abnormal vision Drosophila homolog of like 4; Hu antigen D; Hu-antigen D; HuD; Paraneoplastic encephalomyelitis antigen HuD; PNEM; ELAV like neuron-specific RNA binding protein 4; anti-ELAVL4 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 366

• Applicable Applications for anti-ELAVL4 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- ELAVL4 Picoband antibody, MBS178337, Western blottingAll lanes: Anti ELAVL4 (MBS178337) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)

Immunohistochemistry (IHC)

(Anti- ELAVL4 Picoband antibody, MBS178337, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- ELAVL4 Picoband antibody, MBS178337, IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC)

(Anti- ELAVL4 Picoband antibody, MBS178337, IHC(P)IHC(P): Human Meningeoma Tissue )

Related Product Information for anti-ELAVL4 antibody

Description: Rabbit IgG polyclonal antibody for ELAV-like protein 4(ELAVL4) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

References

1. "Entrez Gene: ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)". 2. Muresu R, Baldini A, Gress T, Posner JB, Furneaux HM, Siniscalco M (Dec 1993). "Mapping of the gene coding for a paraneoplastic encephalomyelitis antigen (HuD) to human chromosome site 1p34". Cytogenet Cell Genet 65(3): 177-8. 3. Nora Perrone-Bizzozero and Federico Bolognani (2002). "Role of HuD and other RNA-binding proteins in neural development and plasticity". J Neurosci Res 68 (2): 121-126. 

NCBI and Uniprot Product Information

• NCBI GI #: 221316767
• NCBI GeneID: 1996
• NCBI Accession #: NP_001138246.1
• NCBI GenBank Nucleotide #: NM_001144774.2
• UniProt Accession #: P26378; Q8IYD4; Q96J74; Q96J75; Q9UD24; B1APY6; B1APY7; B7Z4G7
• Molecular Weight: 40,788 Da
• NCBI Official Full Name: ELAV-like protein 4 isoform 2
• NCBI Official Synonym Full Names: ELAV like neuron-specific RNA binding protein 4
• NCBI Official Symbol: ELAVL4
• NCBI Official Synonym Symbols: HUD; PNEM
• NCBI Protein Information: ELAV-like protein 4
• UniProt Protein Name: ELAV-like protein 4
• Protein Family: ELAV-like protein
• UniProt Gene Name: ELAVL4
• UniProt Synonym Gene Names: HUD; PNEM; HuD
• UniProt Entry Name: ELAV4_HUMAN

Uniprot Description

ELAVL4: May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. Belongs to the RRM elav family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 1p34

Molecular Function: AU-rich element binding; mRNA 3'-UTR binding; nucleotide binding; RNA binding

Biological Process: mRNA processing; RNA processing