Rabbit anti-Human EIF5 Polyclonal Antibody | anti-EIF5 antibody

EIF5 (Eukaryotic Translation Initiation Factor 5, eIF-5) (HRP)

Cat. Num. AAA6377166

• Gene Names: EIF5; EIF-5; EIF-5A
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF5; Polyclonal Antibody; EIF5 (Eukaryotic Translation Initiation Factor 5; eIF-5) (HRP); anti-EIF5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human EIF5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-EIF5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human EIF5, aa1-431 (AAH32866.1).
• Immunogen Sequence: MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EIF5 expression in transfected 293T cell line by EIF5 rabbit polyclonal antibody. Lane 1: EIF5 transfected lysate (49.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-EIF5 antibody

Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).

Product Categories/Family for anti-EIF5 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 34193752
• NCBI GeneID: 1983
• Molecular Weight: 49,223 Da
• NCBI Official Full Name: Homo sapiens eukaryotic translation initiation factor 5, mRNA
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 5
• NCBI Official Symbol: EIF5
• NCBI Official Synonym Symbols: EIF-5; EIF-5A
• NCBI Protein Information: eukaryotic translation initiation factor 5

NCBI Description

Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).[supplied by OMIM, May 2010]