Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EIF4G1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateEIF4G1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit EIF4G1 Polyclonal Antibody | anti-EIF4G1 antibody

EIF4G1 antibody - middle region

Gene Names
EIF4G1; P220; EIF4F; EIF4G; EIF4GI; PARK18; EIF-4G1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF4G1; Polyclonal Antibody; EIF4G1 antibody - middle region; anti-EIF4G1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ
Sequence Length
1599
Applicable Applications for anti-EIF4G1 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EIF4G1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EIF4G1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateEIF4G1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-EIF4G1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateEIF4G1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-EIF4G1 antibody
This is a rabbit polyclonal antibody against EIF4G1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.The protein encoded by this gene is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. Alternative splicing results in five transcript variants encoding four distinct isoforms.
Product Categories/Family for anti-EIF4G1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
175kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4 gamma 1 isoform 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4 gamma 1
NCBI Official Symbol
EIF4G1
NCBI Official Synonym Symbols
P220; EIF4F; EIF4G; EIF4GI; PARK18; EIF-4G1
NCBI Protein Information
eukaryotic translation initiation factor 4 gamma 1
UniProt Protein Name
Eukaryotic translation initiation factor 4 gamma 1
UniProt Gene Name
EIF4G1
UniProt Synonym Gene Names
EIF4F; EIF4G; EIF4GI; eIF-4-gamma 1; eIF-4G 1; eIF-4G1
UniProt Entry Name
IF4G1_HUMAN

NCBI Description

The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage. [provided by RefSeq, Aug 2010]

Uniprot Description

eIF4G: Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome. eIF4F is a multi-subunit complex, the composition of which varies with external and internal environmental conditions. It is composed of at least EIF4A, EIF4E and EIF4G1/EIF4G3. Interacts with eIF3, mutually exclusive with EIF4A1 or EIFA2, EIF4E and through its N-terminus with PAPBC1. Interacts through its C-terminus with the serine/threonine kinases MKNK1, and with MKNK2. Appears to act as a scaffold protein, holding these enzymes in place to phosphorylate EIF4E. Non-phosphorylated EIF4EBP1 competes with EIF4G1/EIF4G3 to interact with EIF4E; insulin stimulated MAP-kinase (MAPK1 and MAPK3) phosphorylation of EIF4EBP1 causes dissociation of the complex allowing EIF4G1/EIF4G3 to bind and consequent initiation of translation. EIF4G1/EIF4G3 interacts with PABPC1 to bring about circularization of the mRNA. Rapamycin can attenuate insulin stimulation mediated by FKBPs. Interacts with EIF4E3. Interacts with CIRBP and MIF4GD. Interacts with rotavirus A NSP3; in this interaction, NSP3 takes the place of PABPC1 thereby inducing shutoff of host protein synthesis. Interacts with RBM4. Belongs to the eIF4G family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Translation; Translation initiation

Chromosomal Location of Human Ortholog: 3q27.1

Cellular Component: membrane; eukaryotic translation initiation factor 4F complex; cytosol

Molecular Function: protein binding; translation factor activity, nucleic acid binding; translation initiation factor activity

Biological Process: poly(A) tail shortening; cellular protein metabolic process; translation; viral reproduction; cytokine and chemokine mediated signaling pathway; insulin receptor signaling pathway; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; regulation of translational initiation; mRNA catabolic process, deadenylation-dependent decay

Research Articles on EIF4G1

Similar Products

Product Notes

The EIF4G1 eif4g1 (Catalog #AAA3205321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF4G1 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4G1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF4G1 eif4g1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAVPEVENQP PAGSNPGPES EGSGVPPRPE EADETWDSKE DKIHNAENIQ. It is sometimes possible for the material contained within the vial of "EIF4G1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.