Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-EIF2B2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic near intercalated discsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit EIF2B2 Polyclonal Antibody | anti-EIF2B2 antibody

EIF2B2 Antibody - middle region

Gene Names
EIF2B2; EIF2B; EIF-2Bbeta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
EIF2B2; Polyclonal Antibody; EIF2B2 Antibody - middle region; anti-EIF2B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAEC
Sequence Length
351
Applicable Applications for anti-EIF2B2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human EIF2B2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-EIF2B2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic near intercalated discsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-EIF2B2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic near intercalated discsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-EIF2B2 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-EIF2B2 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Related Product Information for anti-EIF2B2 antibody
This is a rabbit polyclonal antibody against EIF2B2. It was validated on Western Blot

Target Description: This gene encodes the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation.
Product Categories/Family for anti-EIF2B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
translation initiation factor eIF-2B subunit beta
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2B subunit beta
NCBI Official Symbol
EIF2B2
NCBI Official Synonym Symbols
EIF2B; EIF-2Bbeta
NCBI Protein Information
translation initiation factor eIF-2B subunit beta
UniProt Protein Name
Translation initiation factor eIF-2B subunit beta
UniProt Gene Name
EIF2B2
UniProt Synonym Gene Names
EIF2BB
UniProt Entry Name
EI2BB_HUMAN

NCBI Description

This gene encodes the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation. [provided by RefSeq, Aug 2011]

Uniprot Description

eIF2B-beta: eukaryotic translation initiation factor 2B, subunit 5. A translational regulatory protein that functions in the early steps of protein synthesis by catalyzing the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Mutation in EIF2B5 causes childhood ataxia with central nervous system hypomyelination/ vanishing white matter leukodystrophy.

Protein type: Cell development/differentiation; RNA-binding; Translation; GEFs; GEFs, misc.

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: eukaryotic translation initiation factor 2B complex; cytoplasm; cytosol

Molecular Function: protein binding; GTP binding; guanyl-nucleotide exchange factor activity; translation initiation factor activity; S-methyl-5-thioribose-1-phosphate isomerase activity; ATP binding

Biological Process: myelination; response to peptide hormone stimulus; central nervous system development; translation; cellular response to stimulus; cellular protein metabolic process; ovarian follicle development; methionine salvage; response to heat; translational initiation; response to glucose stimulus; gene expression; oligodendrocyte development; regulation of translational initiation; positive regulation of GTPase activity

Disease: Leukoencephalopathy With Vanishing White Matter

Research Articles on EIF2B2

Similar Products

Product Notes

The EIF2B2 eif2b2 (Catalog #AAA3216856) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF2B2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF2B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the EIF2B2 eif2b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGTMENIAAQ ALEHIHSNEV IMTIGFSRTV EAFLKEAARK RKFHVIVAEC. It is sometimes possible for the material contained within the vial of "EIF2B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.