Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of EGLN3 expression in transfected 293T cell line by EGLN3 polyclonal antibody. Lane 1: EGLN3 transfected lysate (27.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human EGLN3 Polyclonal Antibody | anti-EGLN3 antibody

EGLN3 (Egl Nine Homolog 3, HPH-1, Hypoxia-inducible Factor Prolyl Hydroxylase 3, HIF-PH3, HIF-prolyl Hydroxylase 3, HPH-3, Prolyl Hydroxylase Domain-containing Protein 3, FLJ21620, HIFPH3, MGC125998, MGC125999, PHD3) APC

Gene Names
EGLN3; PHD3; HIFPH3; HIFP4H3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EGLN3; Polyclonal Antibody; EGLN3 (Egl Nine Homolog 3; HPH-1; Hypoxia-inducible Factor Prolyl Hydroxylase 3; HIF-PH3; HIF-prolyl Hydroxylase 3; HPH-3; Prolyl Hydroxylase Domain-containing Protein 3; FLJ21620; HIFPH3; MGC125998; MGC125999; PHD3) APC; anti-EGLN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EGLN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EGLN3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EGLN3, aa1-239 (NP_071356.1).
Immunogen Sequence
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EGLN3 expression in transfected 293T cell line by EGLN3 polyclonal antibody. Lane 1: EGLN3 transfected lysate (27.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EGLN3 expression in transfected 293T cell line by EGLN3 polyclonal antibody. Lane 1: EGLN3 transfected lysate (27.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EGLN3 antibody
Prolyl hydroxylase 3 (PHD3) is a 27kD enzyme expressed abundantly in all tissues with the highest expression in testis. Hypoxia inducible factor-1 (HIF-1) is a transcriptional complex, consisting of an alpha and beta subunit, which plays a key role in coordinating the cellular response to hypoxia. During normal oxygen conditions, the alpha subunit of HIF-1 is rapidly degraded, however when hypoxia occurs this degradation is suppressed and HIF-1 activates the transcription of various genes important for survival and adaptation to hypoxia. Prolyl hydroxylase 3 catalyses the hydroxylation of specific prolyl residues within the HIF-1 alpha subunit, thereby targeting this subunit for degradation. Prolyl hydroxylase 3 might also play a role in cell growth regulation in muscle cells and apoptosis in neuronal tissue.
Product Categories/Family for anti-EGLN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,261 Da
NCBI Official Full Name
egl nine homolog 3
NCBI Official Synonym Full Names
egl-9 family hypoxia-inducible factor 3
NCBI Official Symbol
EGLN3
NCBI Official Synonym Symbols
PHD3; HIFPH3; HIFP4H3
NCBI Protein Information
egl nine homolog 3; HIF prolyl hydroxylase 3; HIF-PH3; HIF-prolyl hydroxylase 3; HPH-1; HPH-3; egl nine-like protein 3 isoform; hypoxia-inducible factor prolyl hydroxylase 3; prolyl hydroxylase domain-containing protein 3
UniProt Protein Name
Egl nine homolog 3
Protein Family
UniProt Gene Name
EGLN3
UniProt Synonym Gene Names
HIF-PH3; HIF-prolyl hydroxylase 3; HPH-3; PHD3
UniProt Entry Name
EGLN3_HUMAN

Uniprot Description

EGLN3: Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylation on the NODD site by EGLN3 appears to require prior hydroxylation on the CODD site. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN3 is the most important isozyme in limiting physiological activation of HIFs (particularly HIF2A) in hypoxia. Also hydroxylates PKM in hypoxia, limiting glycolysis. Under normoxia, hydroxylates and regulates the stability of ADRB2. Regulator of cardiomyocyte and neuronal apoptosis. In cardiomyocytes, inhibits the anti-apoptotic effect of BCL2 by disrupting the BAX-BCL2 complex. In neurons, has a NGF-induced proapoptotic effect, probably through regulating CASP3 activity. Also essential for hypoxic regulation of neutrophilic inflammation.

Protein type: Oxidoreductase; EC 1.14.11.29

Chromosomal Location of Human Ortholog: 14q13.1

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; L-ascorbic acid binding; iron ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; peptidyl-proline 4-dioxygenase activity

Biological Process: caspase activation; apoptosis; regulation of neuron apoptosis; response to hypoxia; protein amino acid hydroxylation; peptidyl-proline hydroxylation to 4-hydroxy-L-proline; response to DNA damage stimulus; regulation of cell proliferation

Research Articles on EGLN3

Similar Products

Product Notes

The EGLN3 egln3 (Catalog #AAA6377086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EGLN3 (Egl Nine Homolog 3, HPH-1, Hypoxia-inducible Factor Prolyl Hydroxylase 3, HIF-PH3, HIF-prolyl Hydroxylase 3, HPH-3, Prolyl Hydroxylase Domain-containing Protein 3, FLJ21620, HIFPH3, MGC125998, MGC125999, PHD3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EGLN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EGLN3 egln3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EGLN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.