Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EGLN2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit EGLN2 Polyclonal Antibody | anti-EGLN2 antibody

EGLN2 antibody - N-terminal region

Gene Names
EGLN2; EIT6; PHD1; EIT-6; HPH-1; HPH-3; HIFPH1; HIF-PH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EGLN2; Polyclonal Antibody; EGLN2 antibody - N-terminal region; anti-EGLN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN
Sequence Length
146
Applicable Applications for anti-EGLN2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EGLN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EGLN2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-EGLN2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-EGLN2 antibody
This is a rabbit polyclonal antibody against EGLN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms.
Product Categories/Family for anti-EGLN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
egl nine homolog 2 (C. elegans), isoform CRA_a
NCBI Official Synonym Full Names
egl-9 family hypoxia inducible factor 2
NCBI Official Symbol
EGLN2
NCBI Official Synonym Symbols
EIT6; PHD1; EIT-6; HPH-1; HPH-3; HIFPH1; HIF-PH1
NCBI Protein Information
egl nine homolog 2
UniProt Protein Name
Egl nine homolog 2
Protein Family
UniProt Gene Name
EGLN2
UniProt Synonym Gene Names
EIT6; HIF-PH1; HIF-prolyl hydroxylase 1; HPH-1; PHD1
UniProt Entry Name
EGLN2_HUMAN

NCBI Description

The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011]

Uniprot Description

EGLN2: Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: EC 1.14.11.29; Oxidoreductase

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: nucleoplasm; cytosol; nucleus

Molecular Function: protein binding; oxygen sensor activity; L-ascorbic acid binding; ferrous iron binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; peptidyl-proline 4-dioxygenase activity

Biological Process: estrogen receptor signaling pathway; cell redox homeostasis; regulation of neuron apoptosis; positive regulation of protein catabolic process; response to hypoxia; peptidyl-proline hydroxylation to 4-hydroxy-L-proline; regulation of cell growth

Research Articles on EGLN2

Similar Products

Product Notes

The EGLN2 egln2 (Catalog #AAA3202261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EGLN2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EGLN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EGLN2 egln2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MCLPSPSKPT SLHPCQAMVA CYPGNGLGYV RHVDNPHGDG RCITCIYYLN. It is sometimes possible for the material contained within the vial of "EGLN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.