Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: EFNB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit EFNB1 Polyclonal Antibody | anti-EFNB1 antibody

EFNB1 antibody - middle region

Gene Names
EFNB1; CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EFNB1; Polyclonal Antibody; EFNB1 antibody - middle region; anti-EFNB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG
Sequence Length
346
Applicable Applications for anti-EFNB1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EFNB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: EFNB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: EFNB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: EFNB1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EFNB1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: EFNB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EFNB1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-EFNB1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-EFNB1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human kidney)
Related Product Information for anti-EFNB1 antibody
This is a rabbit polyclonal antibody against EFNB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
ephrin-B1
NCBI Official Synonym Full Names
ephrin B1
NCBI Official Symbol
EFNB1
NCBI Official Synonym Symbols
CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2
NCBI Protein Information
ephrin-B1
UniProt Protein Name
Ephrin-B1
Protein Family
UniProt Gene Name
EFNB1
UniProt Synonym Gene Names
EFL3; EPLG2; LERK2; ELK-L; LERK-2
UniProt Entry Name
EFNB1_HUMAN

NCBI Description

The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNB1: a type I membrane protein of the ephrin family. A ligand of Eph-related receptor tyrosine kinases EphB1 and EphA1. Ephrins and ephrin receptors mediate numerous developmental processes, particularly in the nervous system. Ephrin-B1 may play a role in cell adhesion and functions in the development or maintenance of the nervous system. Binding to its receptor induces the collapse of commissural axons/growth cones in vitro. Induced by TNF-alpha. Expressed in brain, heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: Xq12

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; synapse; nucleus; lipid raft

Molecular Function: protein binding; ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway; positive regulation of T cell proliferation; cell adhesion; embryonic pattern specification; neural crest cell migration

Disease: Craniofrontonasal Syndrome

Research Articles on EFNB1

Similar Products

Product Notes

The EFNB1 efnb1 (Catalog #AAA3208217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFNB1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EFNB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EFNB1 efnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRPSKEADNT VKMATQAPGS RGSLGDSDGK HETVNQEEKS GPGASGGSSG. It is sometimes possible for the material contained within the vial of "EFNB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.