Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: EFNA2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit EFNA2 Polyclonal Antibody | anti-EFNA2 antibody

EFNA2 antibody - middle region

Gene Names
EFNA2; ELF-1; EPLG6; LERK6; HEK7-L; LERK-6
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EFNA2; Polyclonal Antibody; EFNA2 antibody - middle region; anti-EFNA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK
Sequence Length
213
Applicable Applications for anti-EFNA2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: EFNA2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: EFNA2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-EFNA2 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-EFNA2 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-EFNA2 antibody
This is a rabbit polyclonal antibody against EFNA2. It was validated on Western Blot

Target Description: This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ephrin-A2
NCBI Official Synonym Full Names
ephrin A2
NCBI Official Symbol
EFNA2
NCBI Official Synonym Symbols
ELF-1; EPLG6; LERK6; HEK7-L; LERK-6
NCBI Protein Information
ephrin-A2
UniProt Protein Name
Ephrin-A2
Protein Family
UniProt Gene Name
EFNA2
UniProt Synonym Gene Names
EPLG6; LERK6; LERK-6; HEK7-L
UniProt Entry Name
EFNA2_HUMAN

NCBI Description

This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA2: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. With the EPHA2 receptor may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis. Belongs to the ephrin family.

Protein type: Membrane protein, GPI anchor; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular region; plasma membrane; perikaryon; neuromuscular junction

Molecular Function: ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; olfactory bulb development; ephrin receptor signaling pathway; osteoclast differentiation; bone remodeling

Research Articles on EFNA2

Similar Products

Product Notes

The EFNA2 efna2 (Catalog #AAA3215192) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFNA2 antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EFNA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EFNA2 efna2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGAPLPPAER MEHYVLYMVN GEGHASCDHR QRGFKRWECN RPAAPGGPLK. It is sometimes possible for the material contained within the vial of "EFNA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.