Rabbit EFEMP1 Polyclonal Antibody | anti-EFEMP1 antibody

EFEMP1 antibody - middle region

Cat. Num. AAA3205857

• Gene Names: EFEMP1; DHRD; DRAD; FBNL; MLVT; MTLV; S1-5; FBLN3; FIBL-3
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: EFEMP1; Polyclonal Antibody; EFEMP1 antibody - middle region; anti-EFEMP1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV
• Sequence Length: 493

• Applicable Applications for anti-EFEMP1 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-EFEMP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, plasma membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Related Product Information for anti-EFEMP1 antibody

This is a rabbit polyclonal antibody against EFEMP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Product Categories/Family for anti-EFEMP1 antibody

Polyclonal; Transcription Regulation; Disease Related; Tissue Specific & Cell Marker; Phosphorylation; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 86788015
• NCBI GeneID: 2202
• NCBI Accession #: NP_001034437
• NCBI GenBank Nucleotide #: NM_001039348
• UniProt Accession #: Q12805
• Molecular Weight: 53kDa
• NCBI Official Full Name: EGF-containing fibulin-like extracellular matrix protein 1
• NCBI Official Synonym Full Names: EGF containing fibulin extracellular matrix protein 1
• NCBI Official Symbol: EFEMP1
• NCBI Official Synonym Symbols: DHRD; DRAD; FBNL; MLVT; MTLV; S1-5; FBLN3; FIBL-3
• NCBI Protein Information: EGF-containing fibulin-like extracellular matrix protein 1
• UniProt Protein Name: EGF-containing fibulin-like extracellular matrix protein 1
• Protein Family: EGF-containing fibulin-like extracellular matrix protein
• UniProt Gene Name: EFEMP1
• UniProt Synonym Gene Names: FBLN3; FBNL; FIBL-3
• UniProt Entry Name: FBLN3_HUMAN

NCBI Description

This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009]

Uniprot Description

EFEMP1: Binds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth. Defects in EFEMP1 are a cause of Doyne honeycomb retinal dystrophy (DHRD); also known as malattia leventinese (MLVT) (ML). DHRD is an autosomal dominant disease characterized by yellow-white deposits known as drusen that accumulate beneath the retinal pigment epithelium. Belongs to the fibulin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2p16

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: protein binding; growth factor activity; epidermal growth factor receptor activity; calcium ion binding; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; extracellular matrix organization and biogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; visual perception; negative regulation of chondrocyte differentiation

Disease: Doyne Honeycomb Retinal Dystrophy