Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-EFEMP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, plasma membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit EFEMP1 Polyclonal Antibody | anti-EFEMP1 antibody

EFEMP1 antibody - middle region

Gene Names
EFEMP1; DHRD; DRAD; FBNL; MLVT; MTLV; S1-5; FBLN3; FIBL-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
EFEMP1; Polyclonal Antibody; EFEMP1 antibody - middle region; anti-EFEMP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV
Sequence Length
493
Applicable Applications for anti-EFEMP1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-EFEMP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, plasma membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-EFEMP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, plasma membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-EFEMP1 antibody
This is a rabbit polyclonal antibody against EFEMP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
EGF-containing fibulin-like extracellular matrix protein 1
NCBI Official Synonym Full Names
EGF containing fibulin extracellular matrix protein 1
NCBI Official Symbol
EFEMP1
NCBI Official Synonym Symbols
DHRD; DRAD; FBNL; MLVT; MTLV; S1-5; FBLN3; FIBL-3
NCBI Protein Information
EGF-containing fibulin-like extracellular matrix protein 1
UniProt Protein Name
EGF-containing fibulin-like extracellular matrix protein 1
UniProt Gene Name
EFEMP1
UniProt Synonym Gene Names
FBLN3; FBNL; FIBL-3
UniProt Entry Name
FBLN3_HUMAN

NCBI Description

This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009]

Uniprot Description

EFEMP1: Binds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth. Defects in EFEMP1 are a cause of Doyne honeycomb retinal dystrophy (DHRD); also known as malattia leventinese (MLVT) (ML). DHRD is an autosomal dominant disease characterized by yellow-white deposits known as drusen that accumulate beneath the retinal pigment epithelium. Belongs to the fibulin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2p16

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: protein binding; growth factor activity; epidermal growth factor receptor activity; calcium ion binding; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; extracellular matrix organization and biogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; visual perception; negative regulation of chondrocyte differentiation

Disease: Doyne Honeycomb Retinal Dystrophy

Research Articles on EFEMP1

Similar Products

Product Notes

The EFEMP1 efemp1 (Catalog #AAA3205857) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFEMP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EFEMP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the EFEMP1 efemp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NENGEFYLRQ TSPVSAMLVL VKSLSGPREH IVDLEMLTVS SIGTFRTSSV. It is sometimes possible for the material contained within the vial of "EFEMP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.