Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse pancreas using EDN3 Antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Mouse EDN3 Polyclonal Antibody | anti-EDN3 antibody

EDN3 Polyclonal Antibody

Gene Names
EDN3; ET3; ET-3; WS4B; HSCR4; PPET3
Reactivity
Mouse
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
EDN3; Polyclonal Antibody; EDN3 Polyclonal Antibody; ET-3; ET3; HSCR4; PPET3; WS4B; anti-EDN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
AGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Sequence Length
198
Applicable Applications for anti-EDN3 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human EDN3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse pancreas using EDN3 Antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse pancreas using EDN3 Antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-EDN3 antibody
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-EDN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa/25kDa
NCBI Official Full Name
endothelin-3 isoform 4 preproprotein
NCBI Official Synonym Full Names
endothelin 3
NCBI Official Symbol
EDN3
NCBI Official Synonym Symbols
ET3; ET-3; WS4B; HSCR4; PPET3
NCBI Protein Information
endothelin-3
UniProt Protein Name
Endothelin-3
Protein Family
UniProt Gene Name
EDN3
UniProt Synonym Gene Names
ET-3; PPET3

NCBI Description

The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Uniprot Description

Endothelins are endothelium-derived vasoconstrictor peptides.

Research Articles on EDN3

Similar Products

Product Notes

The EDN3 edn3 (Catalog #AAA9133984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDN3 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EDN3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the EDN3 edn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGFVPCSQSG DAGRRGVSQA PTAARSEGDC EETVAGPGEE TVAGPGEGTV APTALQGPSP GSPGQEQAAE GAPEHHRSRR CTCFTYKDKE CVYYCHLDII WINTPEQTVP YGLSNYRGSF RGKRSAGPLP GNLQLSHRPH LRCACVGRYD KACLHFCTQT LDVSSNSRTA EKTDKEEEGK VEVKDQQSKQ ALDLHHPKLM PGSGLALAPS TCPRCLFQEG AP. It is sometimes possible for the material contained within the vial of "EDN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.