Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EBF3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Raji cell lysate)

Rabbit EBF3 Polyclonal Antibody | anti-EBF3 antibody

EBF3 antibody - middle region

Gene Names
EBF3; COE3; OE-2; EBF-3; HADDS; O/E-2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
EBF3; Polyclonal Antibody; EBF3 antibody - middle region; anti-EBF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
Sequence Length
551
Applicable Applications for anti-EBF3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EBF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EBF3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Raji cell lysate)

Western Blot (WB) (WB Suggested Anti-EBF3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Raji cell lysate)
Related Product Information for anti-EBF3 antibody
This is a rabbit polyclonal antibody against EBF3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
Product Categories/Family for anti-EBF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
transcription factor COE3
NCBI Official Synonym Full Names
EBF transcription factor 3
NCBI Official Symbol
EBF3
NCBI Official Synonym Symbols
COE3; OE-2; EBF-3; HADDS; O/E-2
NCBI Protein Information
transcription factor COE3
UniProt Protein Name
Transcription factor COE3
Protein Family
UniProt Gene Name
EBF3
UniProt Synonym Gene Names
COE3; EBF-3; O/E-2; OE-2
UniProt Entry Name
COE3_HUMAN

NCBI Description

This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma. [provided by RefSeq, Sep 2011]

Uniprot Description

EBF3: Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'. Belongs to the COE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q26.3

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; multicellular organismal development

Research Articles on EBF3

Similar Products

Product Notes

The EBF3 ebf3 (Catalog #AAA3200592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EBF3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EBF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EBF3 ebf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHTGMMGVNS FSSQLAVNVS ETSQANDQVG YSRNTSSVSP RGYVPSSTPQ. It is sometimes possible for the material contained within the vial of "EBF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.