Immunohistochemistry (IHC)
(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-EBF1 antibody )
Rabbit EBF1 Polyclonal Antibody | anti-EBF1 antibody
EBF1 Antibody
Gene Names
EBF1; EBF; COE1; OLF1; O/E-1
Reactivity
Tested Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EBF1; Polyclonal Antibody; EBF1 Antibody; anti-EBF1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
Sequence Length
591
Applicable Applications for anti-EBF1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards (50ug) human EBF1.
Blocking Peptide
For anti-EBF1 (MBS3204711) antibody is Catalog # MBS3229677
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-EBF1 antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-EBF1 antibody )
Western Blot (WB)
(WB Suggested Anti-EBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-EBF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-EBF1 antibody
This is a rabbit polyclonal antibody against EBF1. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-EBF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
transcription factor COE1 isoform 2
NCBI Official Synonym Full Names
EBF transcription factor 1
NCBI Official Symbol
EBF1
NCBI Official Synonym Symbols
EBF; COE1; OLF1; O/E-1
NCBI Protein Information
transcription factor COE1
UniProt Protein Name
Transcription factor COE1
Protein Family
UniProt Gene Name
EBF1
UniProt Synonym Gene Names
COE1; EBF; O/E-1; OE-1
UniProt Entry Name
COE1_HUMAN
Research Articles on EBF1
Similar Products
Product Notes
The EBF1 ebf1 (Catalog #AAA3204711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EBF1 Antibody reacts with Tested Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EBF1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EBF1 ebf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPSNCSSSSG IFSFSPANMV SAVKQKSAFA PVVRPQTSPP PTCTSTNGNS. It is sometimes possible for the material contained within the vial of "EBF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
