Western Blot (WB)
(Host: RabbitTarget Name: EAF2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human EAF2 Polyclonal Antibody | anti-EAF2 antibody
EAF2 Antibody - C-terminal region
Gene Names
EAF2; U19; BM040; TRAITS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EAF2; Polyclonal Antibody; EAF2 Antibody - C-terminal region; anti-EAF2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD
Sequence Length
260
Applicable Applications for anti-EAF2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EAF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EAF2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EAF2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-EAF2 antibody
This is a rabbit polyclonal antibody against EAF2. It was validated on Western Blot
Target Description: EAF2 acts as a transcriptional transactivator of TCEA1 elongation activity and a transcriptional transactivator of ELL and ELL2 elongation activities. EAF2 is a potent inducer of apoptosis in prostatic and non-prostatic cell lines and inhibits prostate tumor growth in vivo.
Target Description: EAF2 acts as a transcriptional transactivator of TCEA1 elongation activity and a transcriptional transactivator of ELL and ELL2 elongation activities. EAF2 is a potent inducer of apoptosis in prostatic and non-prostatic cell lines and inhibits prostate tumor growth in vivo.
Product Categories/Family for anti-EAF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
ELL-associated factor 2 isoform 1
NCBI Official Synonym Full Names
ELL associated factor 2
NCBI Official Symbol
EAF2
NCBI Official Synonym Symbols
U19; BM040; TRAITS
NCBI Protein Information
ELL-associated factor 2
UniProt Protein Name
ELL-associated factor 2
Protein Family
UniProt Gene Name
EAF2
UniProt Synonym Gene Names
TRAITS
UniProt Entry Name
EAF2_HUMAN
Uniprot Description
EAF2: Acts as a transcriptional transactivator of TCEA1 elongation activity. Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo. Belongs to the EAF family. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 3q13.33
Cellular Component: transcription elongation factor complex; nuclear speck
Molecular Function: protein binding
Biological Process: transcription, DNA-dependent; apoptosis; positive regulation of transcription from RNA polymerase II promoter; negative regulation of cell growth
Research Articles on EAF2
Similar Products
Product Notes
The EAF2 eaf2 (Catalog #AAA3216548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EAF2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EAF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EAF2 eaf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSSSEDSSSD SEDEDCKSST SDTGNCVSGH PTMTQYRIPD IDASHNRFRD. It is sometimes possible for the material contained within the vial of "EAF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
