Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DUT expression in transfected 293T cell line by DUT polyclonal antibody. Lane 1: DUT transfected lysate (26.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human DUT Polyclonal Antibody | anti-DUT antibody

DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase, Mitochondrial, dUTPase, dUTP Pyrophosphatase) (FITC)

Gene Names
DUT; dUTPase
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DUT; Polyclonal Antibody; DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase; Mitochondrial; dUTPase; dUTP Pyrophosphatase) (FITC); anti-DUT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DUT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-DUT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DUT, aa1-252 (NP_001020419.1).
Immunogen Sequence
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DUT expression in transfected 293T cell line by DUT polyclonal antibody. Lane 1: DUT transfected lysate (26.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DUT expression in transfected 293T cell line by DUT polyclonal antibody. Lane 1: DUT transfected lysate (26.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DUT antibody
Deoxyuridine triphosphate nucleotidohydrolase (dUTPase) is a ubiquitous enzyme that functions in the hydrolysis of dUTP to dUMP and pyrophosphate. Canman and co-workers have demonstrated that, in certain human tumor cell lines, increased levels of dUTPase are responsible for an increase in resistance to the cancer chemotherapeutic agent fluorodeoxyuridine (FUdR), a thymidine synthase inhibitor. Two distinct forms of dUTPase exist in humans. Cellular fractionation experiments suggest that the more abundant, lower mass form of dUTPase (DUT-N) localizes in the nucleus, while the higher mass form (DUT-M) is associated with the mitochondria.
Product Categories/Family for anti-DUT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,748 Da
NCBI Official Full Name
deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial isoform 1
NCBI Official Synonym Full Names
deoxyuridine triphosphatase
NCBI Official Symbol
DUT
NCBI Official Synonym Symbols
dUTPase
NCBI Protein Information
deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP nucleotidohydrolase; dUTP pyrophosphatase
UniProt Protein Name
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
UniProt Gene Name
DUT
UniProt Synonym Gene Names
dUTPase
UniProt Entry Name
DUT_HUMAN

NCBI Description

This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008]

Uniprot Description

dUTPase: This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. Belongs to the dUTPase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Motility/polarity/chemotaxis; Mitochondrial; DNA replication; Nuclear receptor co-regulator; Nucleotide Metabolism - pyrimidine; EC 3.6.1.23

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: nucleoplasm; mitochondrion; nucleus

Molecular Function: protein binding; magnesium ion binding; dUTP diphosphatase activity

Biological Process: dUTP catabolic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleoside biosynthetic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; DNA replication; dUMP biosynthetic process

Research Articles on DUT

Similar Products

Product Notes

The DUT dut (Catalog #AAA6376758) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase, Mitochondrial, dUTPase, dUTP Pyrophosphatase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DUT dut for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DUT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.