Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STYXL1 polyclonal antibody. Western Blot analysis of STYXL1 expression in human colon.)

Mouse anti-Human DUSP24 Polyclonal Antibody | anti-DUSP26 antibody

DUSP24 (STYXL1, MKSTYX, Serine/Threonine/Tyrosine-interacting-like Protein 1, Dual Specificity Phosphatase Inhibitor MK-STYX, Dual Specificity Protein Phosphatase 24, Map Kinase Phosphatase-like Protein MK-STYX)

Gene Names
DUSP26; MKP8; LDP-4; NATA1; SKRP3; DUSP24
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DUSP24; Polyclonal Antibody; DUSP24 (STYXL1; MKSTYX; Serine/Threonine/Tyrosine-interacting-like Protein 1; Dual Specificity Phosphatase Inhibitor MK-STYX; Dual Specificity Protein Phosphatase 24; Map Kinase Phosphatase-like Protein MK-STYX); Anti -DUSP24 (STYXL1; anti-DUSP26 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STYXL1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY
Applicable Applications for anti-DUSP26 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human STYXL1, aa1-313 (NP_057170.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STYXL1 polyclonal antibody. Western Blot analysis of STYXL1 expression in human colon.)

Western Blot (WB) (STYXL1 polyclonal antibody. Western Blot analysis of STYXL1 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of STYXL1 expression in transfected 293T cell line by STYXL1 polyclonal antibody. Lane 1: STYXL1 transfected lysate (34.43kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STYXL1 expression in transfected 293T cell line by STYXL1 polyclonal antibody. Lane 1: STYXL1 transfected lysate (34.43kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DUSP26 antibody
DUSP24 is probable pseudophosphatase. It contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases.
Product Categories/Family for anti-DUSP26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23,946 Da
NCBI Official Full Name
Dual specificity protein phosphatase 26
NCBI Official Synonym Full Names
dual specificity phosphatase 26 (putative)
NCBI Official Symbol
DUSP26
NCBI Official Synonym Symbols
MKP8; LDP-4; NATA1; SKRP3; DUSP24
NCBI Protein Information
dual specificity protein phosphatase 26; DSP-4; MKP-8; MAP kinase phosphatase 8; dual specificity phosphatase SKRP3; dual-specificity phosphatase SKRP3; mitogen-activated protein kinase phosphatase 8; Novel amplified gene in thyroid anaplastic cancer; low-molecular-mass dual-specificity phosphatase 4
UniProt Protein Name
Dual specificity protein phosphatase 26
UniProt Gene Name
DUSP26
UniProt Synonym Gene Names
DUSP24; LDP4; MKP8; NATA1; SKRP3; DSP-4; LDP-4; MAP kinase phosphatase 8; MKP-8
UniProt Entry Name
DUS26_HUMAN

NCBI Description

This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Uniprot Description

DUSP26: Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK). Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.16; EC 3.1.3.48; Protein phosphatase, dual-specificity; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: Golgi apparatus; mitochondrion; cytoplasm; nucleus

Molecular Function: protein binding; p53 binding; phosphoserine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: positive regulation of cell adhesion; negative regulation of transcription from RNA polymerase II promoter; protein amino acid dephosphorylation

Research Articles on DUSP26

Similar Products

Product Notes

The DUSP26 dusp26 (Catalog #AAA6007830) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DUSP24 (STYXL1, MKSTYX, Serine/Threonine/Tyrosine-interacting-like Protein 1, Dual Specificity Phosphatase Inhibitor MK-STYX, Dual Specificity Protein Phosphatase 24, Map Kinase Phosphatase-like Protein MK-STYX) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DUSP26 dusp26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGLLLCEPT ELYNILNQAT KLSRLTDPNY LCLLDVRSKW EYDESHVITA LRVKKKNNEY LLPESVDLEC VKYCVVYDNN SSTLEILLKD DDDDSDSDGD GKDLVPQAAI EYGRILTRLT HHPVYILKGG YERFSGTYHF LRTQKIIWMP QELDAFQPYP IEIVPGKVFV GNFSQACDPK IQKDLKIKAH VNVSMDTGPF FAGDADKLLH IRIEDSPEAQ ILPFLRHMCH FIEIHHHLGS VILIFSTQGI SRSCAAIIAY LMHSNEQTLQ RSWAYVKKCK NNMCPNRGLV SQLLEWEKTI LGDSITNIMD PLY. It is sometimes possible for the material contained within the vial of "DUSP24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.