Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DS13B antibody Titration: 1 ug/mLSample Type: Human 721_B Whole Cell)

Rabbit anti-Human DUSP13 Polyclonal Antibody | anti-DUSP13 antibody

DUSP13 Antibody - N-terminal region

Gene Names
DUSP13; BEDP; MDSP; TMDP; SKRP4; DUSP13A; DUSP13B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DUSP13; Polyclonal Antibody; DUSP13 Antibody - N-terminal region; anti-DUSP13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVW
Sequence Length
198
Applicable Applications for anti-DUSP13 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DS13B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DS13B antibody Titration: 1 ug/mLSample Type: Human 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-DS13B antibody Titration: 1 ug/mLSample Type: Human 721_B Whole Cell)
Related Product Information for anti-DUSP13 antibody
This is a rabbit polyclonal antibody against DS13B. It was validated on Western Blot

Target Description: Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined.
Product Categories/Family for anti-DUSP13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
dual specificity protein phosphatase 13 isoform X7
NCBI Official Synonym Full Names
dual specificity phosphatase 13
NCBI Official Symbol
DUSP13
NCBI Official Synonym Symbols
BEDP; MDSP; TMDP; SKRP4; DUSP13A; DUSP13B
NCBI Protein Information
dual specificity protein phosphatase 13
UniProt Protein Name
Dual specificity protein phosphatase 13 isoform B
UniProt Gene Name
DUSP13
UniProt Synonym Gene Names
DUSP13B; TMDP; DUSP13B
UniProt Entry Name
DS13B_HUMAN

NCBI Description

Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]

Uniprot Description

DUSP13: May be involved in the regulation of meiosis and/or differentiation of testicular germ cells during spermatogenesis. Exhibits intrinsic phosphatase activity towards both phospho- seryl/threonyl and -tyrosyl residues of myelin basic protein, with similar specific activities in vitro. Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: Motility/polarity/chemotaxis; Cell cycle regulation; Protein phosphatase, dual-specificity; EC 3.1.3.16; EC 3.1.3.48

Chromosomal Location of Human Ortholog: 10q22.2

Cellular Component: cytoplasm

Molecular Function: protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity

Biological Process: meiosis; spermatogenesis; protein amino acid dephosphorylation

Research Articles on DUSP13

Similar Products

Product Notes

The DUSP13 dusp13 (Catalog #AAA3219712) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUSP13 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DUSP13 dusp13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW. It is sometimes possible for the material contained within the vial of "DUSP13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.