Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DUOXA1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit DUOXA1 Polyclonal Antibody | anti-DUOXA1 antibody

DUOXA1 antibody - C-terminal region

Gene Names
DUOXA1; NIP; mol; NUMBIP
Reactivity
Cow, Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DUOXA1; Polyclonal Antibody; DUOXA1 antibody - C-terminal region; anti-DUOXA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL
Sequence Length
483
Applicable Applications for anti-DUOXA1 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 79%; Human: 100%; Pig: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DUOXA1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-DUOXA1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-DUOXA1 antibody
This is a rabbit polyclonal antibody against DUOXA1. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-DUOXA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
dual oxidase maturation factor 1 isoform 1
NCBI Official Synonym Full Names
dual oxidase maturation factor 1
NCBI Official Symbol
DUOXA1
NCBI Official Synonym Symbols
NIP; mol; NUMBIP
NCBI Protein Information
dual oxidase maturation factor 1

NCBI Description

Dual oxidases DUOX1 and DUOX2 are NADPH oxidases which are involved in hydrogen peroxide production necessary for thyroid hormonogenesis. They form a heterodimer with specific maturation factors DUOXA1 and DUOXA2, respectively, which is essential for the maturation and function of the DUOX enzyme complexes. This gene encodes the DUOX1 activator or maturation factor DUOXA1. Rat studies identified a bidirectional promoter which controls the transcription of the DUOX1 and DUOXA1 genes. This protein is cotransported to the cell surface when coexpressed with DUOX1 and is retained in the endoplasmic reticulum when expressed without DUOX1 protein. The expression of this gene or the DUOX1 gene is not suppressed by thyroglobulin (Tg), a macromolecular precursor in thyroid hormone synthesis, while the expression of the DUOX2 and DUOXA2 are significantly suppressed by the Tg. This protein is also a p53-regulated neurogenic factor involved in p53 dependent neuronal differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]

Research Articles on DUOXA1

Similar Products

Product Notes

The DUOXA1 (Catalog #AAA3215124) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUOXA1 antibody - C-terminal region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's DUOXA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DUOXA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEEGGLLSPR YRSMADSPKS QDIPLSEASS TKAYYRPRRL SLVPADVRGL. It is sometimes possible for the material contained within the vial of "DUOXA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.