Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DRD3Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DRD3 Polyclonal Antibody | anti-DRD3 antibody

DRD3 Antibody - N-terminal region

Gene Names
DRD3; D3DR; ETM1; FET1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DRD3; Polyclonal Antibody; DRD3 Antibody - N-terminal region; anti-DRD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKE
Sequence Length
367
Applicable Applications for anti-DRD3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DRD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DRD3Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DRD3Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DRD3 antibody
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Product Categories/Family for anti-DRD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
D(3) dopamine receptor isoform a
NCBI Official Synonym Full Names
dopamine receptor D3
NCBI Official Symbol
DRD3
NCBI Official Synonym Symbols
D3DR; ETM1; FET1
NCBI Protein Information
D(3) dopamine receptor
UniProt Protein Name
D(3) dopamine receptor
Protein Family
UniProt Gene Name
DRD3
UniProt Entry Name
DRD3_HUMAN

NCBI Description

This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD). [provided by RefSeq, Jul 2008]

Uniprot Description

DRD3: Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation. Genetic variation in DRD3 is associated with essential tremor hereditary type 1 (ETM1). ETM1 is the most common movement disorder. The main feature is postural tremor of the arms. Head, legs, trunk, voice, jaw, and facial muscles also may be involved. The condition can be aggravated by emotions, hunger, fatigue and temperature extremes, and may cause a functional disability or even incapacitation. Inheritance is autosomal dominant. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q13.3

Cellular Component: cell projection; apical part of cell; endocytic vesicle; integral to plasma membrane; plasma membrane

Molecular Function: dopamine D2 receptor-like receptor activity; protein domain specific binding; protein binding; dopamine binding; drug binding; D1 dopamine receptor binding

Biological Process: synaptic transmission, dopaminergic; regulation of lipid metabolic process; prepulse inhibition; musculoskeletal movement, spinal reflex action; response to morphine; locomotory behavior; negative regulation of transcription from RNA polymerase II promoter; regulation of dopamine secretion; dopamine metabolic process; dopamine receptor, adenylate cyclase inhibiting pathway; learning and/or memory; behavioral response to cocaine; positive regulation of cell proliferation; renin-angiotensin regulation of blood volume; visual learning; circadian regulation of gene expression; negative regulation of blood pressure; negative regulation of sodium:hydrogen antiporter activity; dopamine receptor, adenylate cyclase activating pathway; positive regulation of cytokinesis; response to drug; positive regulation of dopamine receptor signaling pathway; negative regulation of protein secretion; negative regulation of protein kinase B signaling cascade; positive regulation of mitosis; regulation of cAMP metabolic process; response to amphetamine; negative regulation of adenylate cyclase activity; regulation of dopamine uptake; regulation of multicellular organism growth; learning; social behavior; arachidonic acid secretion; response to cocaine; regulation of circadian sleep/wake cycle, sleep; negative regulation of oligodendrocyte differentiation; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; response to ethanol; negative regulation of dopamine receptor signaling pathway; acid secretion; G-protein coupled receptor internalization; positive regulation of transcription from RNA polymerase II promoter

Disease: Schizophrenia; Tremor, Hereditary Essential, 1

Research Articles on DRD3

Similar Products

Product Notes

The DRD3 drd3 (Catalog #AAA3223363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DRD3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DRD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DRD3 drd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSHLNYTCGA ENSTGASQAR PHAYYALSYC ALILAIVFGN GLVCMAVLKE. It is sometimes possible for the material contained within the vial of "DRD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.