Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DPY19L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Rabbit DPY19L2 Polyclonal Antibody | anti-DPY19L2 antibody

DPY19L2 antibody - middle region

Gene Names
DPY19L2; SPGF9; SPATA34
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPY19L2; Polyclonal Antibody; DPY19L2 antibody - middle region; anti-DPY19L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH
Sequence Length
758
Applicable Applications for anti-DPY19L2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPY19L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DPY19L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-DPY19L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-DPY19L2 antibody
This is a rabbit polyclonal antibody against DPY19L2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact functions of DPY19L2 remain unknown.
Product Categories/Family for anti-DPY19L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
probable C-mannosyltransferase DPY19L2
NCBI Official Synonym Full Names
dpy-19 like 2
NCBI Official Symbol
DPY19L2
NCBI Official Synonym Symbols
SPGF9; SPATA34
NCBI Protein Information
probable C-mannosyltransferase DPY19L2
UniProt Protein Name
Probable C-mannosyltransferase DPY19L2
UniProt Gene Name
DPY19L2
UniProt Entry Name
D19L2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the dpy-19 family. It is highly expressed in testis, and is required for sperm head elongation and acrosome formation during spermatogenesis. Mutations in this gene are associated with an infertility disorder, spermatogenic failure type 9 (SPGF9). [provided by RefSeq, Dec 2011]

Uniprot Description

DPY19L2: Required during spermatogenesis for sperm head elongation and acrosome formation. Defects in DPY19L2 are the cause of spermatogenic failure type 9 (SPGF9). An infertility disorder caused by spermatogenesis defects. The most prominent feature is the malformation of the acrosome, which can be totally absent in most severe cases. Additional features are an abnormal nuclear shape and abnormal arrangement of the mitochondria of the spermatozoon. Deletions in DPY19L2 are probably the major cause of SPGF9. Belongs to the dpy-19 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q14.2

Cellular Component: integral to membrane; nuclear inner membrane; nucleus

Molecular Function: mannosyltransferase activity

Biological Process: multicellular organismal development; protein amino acid C-linked glycosylation via 2'-alpha-mannosyl-L-tryptophan; spermatid development

Disease: Spermatogenic Failure 9

Research Articles on DPY19L2

Similar Products

Product Notes

The DPY19L2 dpy19l2 (Catalog #AAA3212359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPY19L2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DPY19L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPY19L2 dpy19l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIGEFNNLPQ EELLQWIKYS TTSDAVFAGA MPTMASIKLS TLHPIVNHPH. It is sometimes possible for the material contained within the vial of "DPY19L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.