Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DPPA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Rabbit anti-Human DPPA4 Polyclonal Antibody | anti-DPPA4 antibody

DPPA4 antibody - N-terminal region

Gene Names
DPPA4; 2410091M23Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPPA4; Polyclonal Antibody; DPPA4 antibody - N-terminal region; anti-DPPA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK
Sequence Length
304
Applicable Applications for anti-DPPA4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DPPA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-DPPA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)
Related Product Information for anti-DPPA4 antibody
This is a rabbit polyclonal antibody against DPPA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DPPA4 may play a role in maintaining cell pluripotentiality.
Product Categories/Family for anti-DPPA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
developmental pluripotency-associated protein 4 isoform 1
NCBI Official Synonym Full Names
developmental pluripotency associated 4
NCBI Official Symbol
DPPA4
NCBI Official Synonym Symbols
2410091M23Rik
NCBI Protein Information
developmental pluripotency-associated protein 4
UniProt Protein Name
Developmental pluripotency-associated protein 4
UniProt Gene Name
DPPA4
UniProt Entry Name
DPPA4_HUMAN

NCBI Description

This gene encodes a nuclear factor that is involved in the maintenance of pluripotency in stem cells and essential for embryogenesis. The encoded protein has a scaffold-attachment factor A/B, acinus and PIAS (SAP) domain that binds DNA and is thought to modify chromatin. Mice with a homozygous knockout of the orthologous gene die during late embryonic development or within hours after birth. Knockout embryos are normal in size at embryonic day 18.5 but exhibit skeletal and lung tissue abnormalities. This gene, when mutated, is highly expressed in embryonal carcinomas, pluripotent germ cell tumors, and other cancers and is thought to play an important role in tumor progression. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]

Uniprot Description

DPPA4: May be involved in the maintenance of active epigenetic status of target genes. May inhibit differentiation of embryonic cells into a primitive ectoderm lineage.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 3q13.13

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on DPPA4

Similar Products

Product Notes

The DPPA4 dppa4 (Catalog #AAA3213193) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPPA4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPPA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPPA4 dppa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLRGSASSTS MEKAKGKEWT STEKSREEDQ QASNQPNSIA LPGTSAKRTK. It is sometimes possible for the material contained within the vial of "DPPA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.